Clone Name | rbart37f03 |
---|---|
Clone Library Name | barley_pub |
>NOS2_CHICK (Q90703) Nitric oxide synthase, inducible (EC 1.14.13.39) (NOS type| II) (Inducible NO synthase) (Inducible NOS) (iNOS) (Macrophage NOS) Length = 1136 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 165 NECPPCLCERNDGYVPPK--LAPILVLGDMSLIRPYEPFW 52 NE PC DG+ PK P +++G + I P+ FW Sbjct: 951 NETVPCFVRSADGFRLPKEPAKPCILIGPGTGIAPFRSFW 990
>DPOL_BPML5 (Q05254) DNA polymerase (EC 2.7.7.7)| Length = 595 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +3 Query: 3 GAKLVLRFIRVRTITQSKRVHTAESGTYPQGPKLERVLGVHIRRSVHI 146 GAK + + + +I +KRVH A S TYP +L + L + R+ +I Sbjct: 446 GAKALAEAVGI-SIPVAKRVHEAFSATYPGVERLSKKLAMEAGRNGYI 492
>ALF_SHIFL (P0AB73) Fructose-bisphosphate aldolase class 2 (EC 4.1.2.13)| (Fructose-bisphosphate aldolase class II) (FBP aldolase) Length = 358 Score = 28.1 bits (61), Expect = 6.6 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +2 Query: 62 SYGRIRDISPRTKIGASFGGTYPSFRSHKHGGHSLFPQILRAS 190 +Y + ISPR I ASFG + + K G L P ILR S Sbjct: 205 AYTELSKISPRFTIAASFGNVHGVY---KPGNVVLTPTILRDS 244
>ALF_ECOLI (P0AB71) Fructose-bisphosphate aldolase class 2 (EC 4.1.2.13)| (Fructose-bisphosphate aldolase class II) (FBP aldolase) Length = 358 Score = 28.1 bits (61), Expect = 6.6 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +2 Query: 62 SYGRIRDISPRTKIGASFGGTYPSFRSHKHGGHSLFPQILRAS 190 +Y + ISPR I ASFG + + K G L P ILR S Sbjct: 205 AYTELSKISPRFTIAASFGNVHGVY---KPGNVVLTPTILRDS 244
>ALF_ECO57 (P0AB72) Fructose-bisphosphate aldolase class 2 (EC 4.1.2.13)| (Fructose-bisphosphate aldolase class II) (FBP aldolase) Length = 358 Score = 28.1 bits (61), Expect = 6.6 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +2 Query: 62 SYGRIRDISPRTKIGASFGGTYPSFRSHKHGGHSLFPQILRAS 190 +Y + ISPR I ASFG + + K G L P ILR S Sbjct: 205 AYTELSKISPRFTIAASFGNVHGVY---KPGNVVLTPTILRDS 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,987,466 Number of Sequences: 219361 Number of extensions: 614459 Number of successful extensions: 1894 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1894 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)