Clone Name | rbart37d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HEM3_NOCFA (Q5YP70) Porphobilinogen deaminase (EC 2.5.1.61) (PBG... | 30 | 5.0 | 2 | PIM1_HUMAN (P11309) Proto-oncogene serine/threonine-protein kina... | 29 | 8.6 | 3 | SHP_MOUSE (Q62227) Nuclear receptor 0B2 (Orphan nuclear receptor... | 29 | 8.6 |
---|
>HEM3_NOCFA (Q5YP70) Porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 346 Score = 29.6 bits (65), Expect = 5.0 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -2 Query: 414 PAQ--LCYECESCRAGLLAALRSQWHKANIALVVATVSLLFLYLIGCSAYKNAHAEAI 247 PAQ L EC S A L+ AL A A VVA +LL GC+A A AE + Sbjct: 196 PAQGALAVECRSEDAALIEALAELDDAATRAAVVAERALLAELEAGCTAPVGALAEVV 253
>PIM1_HUMAN (P11309) Proto-oncogene serine/threonine-protein kinase Pim-1 (EC| 2.7.11.1) Length = 404 Score = 28.9 bits (63), Expect = 8.6 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +2 Query: 356 RSAARRPARHDSHS*HSCAGSLLHRPQSGSAAGRAG 463 RS +R R SHS HS SL H P SGS +G Sbjct: 46 RSHSRNATRSHSHS-HSPRHSLRHSPGSGSCGSSSG 80
>SHP_MOUSE (Q62227) Nuclear receptor 0B2 (Orphan nuclear receptor SHP) (Small| heterodimer partner) Length = 260 Score = 28.9 bits (63), Expect = 8.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -2 Query: 495 FGYVSPTVWTNPARPAADPDCGLWSNDPAQLCYECESCRAGL 370 + +SP+ T P PA+ C P +LC +CR L Sbjct: 22 YALLSPSPRTRPVAPASHSHCLCQQQRPVRLCAPHRTCREAL 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,550,987 Number of Sequences: 219361 Number of extensions: 1195451 Number of successful extensions: 3215 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3214 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)