Clone Name | rbart37c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | 13S1_FAGES (O23878) 13S globulin seed storage protein 1 precurso... | 30 | 3.2 | 2 | YL185_MIMIV (Q5URB5) Hypothetical protein L185 | 28 | 9.2 | 3 | CBX4_MOUSE (O55187) Chromobox protein homolog 4 (Polycomb 2 homo... | 28 | 9.2 |
---|
>13S1_FAGES (O23878) 13S globulin seed storage protein 1 precursor| (Legumin-like protein 1) [Contains: 13S globulin seed storage protein 1 acidic chain; 13S globulin seed storage protein 1 basic chain] Length = 565 Score = 30.0 bits (66), Expect = 3.2 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +1 Query: 100 PDRVTMLNVEK*AITKINTFQLA*LHFTKRSANHIYMY*YQVVLTRRQAQ*HRT--ILQN 273 P R + N I +N+ L L F + SA H+ +Y ++ R H + + Sbjct: 395 PSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRG 454 Query: 274 EGQVEINTDGG 306 EG+V++ D G Sbjct: 455 EGRVQVVGDEG 465
>YL185_MIMIV (Q5URB5) Hypothetical protein L185| Length = 392 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 357 DLRQDLLFKDGIILLQLDHGLLTKSINLVIILL 455 D DL+F + +ILL ++G +I++V ILL Sbjct: 147 DTNNDLIFNNDLILLIFEYGFFEDTIDVVKILL 179
>CBX4_MOUSE (O55187) Chromobox protein homolog 4 (Polycomb 2 homolog) (Pc2)| (MPc2) Length = 551 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +2 Query: 338 FSKHPSGSSTGPSLQRWHNTSSTRSWPSHQKHQPCHHTSHTELG 469 F + P +T P L W S+ P+H H HH H +G Sbjct: 356 FGEQPLQLTTKPDLLAWDPARSSHP-PAHHHHHHHHHHHHHTVG 398 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,488,922 Number of Sequences: 219361 Number of extensions: 1115906 Number of successful extensions: 2863 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2861 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)