| Clone Name | rbart37c03 |
|---|---|
| Clone Library Name | barley_pub |
>FSTL_FLABI (P52838) Flavonol sulfotransferase-like (EC 2.8.2.-)| Length = 309 Score = 29.6 bits (65), Expect = 2.4 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = -1 Query: 160 EMADKLDRIVQDKLQGSGLLL 98 EM +K+D+I+ +KL G+GL+L Sbjct: 288 EMKEKIDKIMDEKLSGTGLIL 308
>SYK_PROMP (Q7UZP0) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 512 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 22 IITIPKIKPQSTQSKVEKTTDN 87 +IT P +KP+ T +K EK+T N Sbjct: 488 VITFPLLKPEITSTKSEKSTSN 509
>KCRB_RAT (P07335) Creatine kinase B-type (EC 2.7.3.2) (Creatine kinase, B| chain) (B-CK) Length = 381 Score = 28.1 bits (61), Expect = 6.9 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 32 FPKLN-HNQHRAKWKRPQITDDSQQQA*PLQLVLDDAVE 145 FP L+ HN H AK P++ + + + P LDDA++ Sbjct: 20 FPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQ 58
>KCRB_MOUSE (Q04447) Creatine kinase B-type (EC 2.7.3.2) (Creatine kinase, B| chain) (B-CK) Length = 381 Score = 28.1 bits (61), Expect = 6.9 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 32 FPKLN-HNQHRAKWKRPQITDDSQQQA*PLQLVLDDAVE 145 FP L+ HN H AK P++ + + + P LDDA++ Sbjct: 20 FPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQ 58
>CP003_HUMAN (O95177) Protein C16orf3| Length = 125 Score = 27.7 bits (60), Expect = 9.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 46 PQSTQSKVEKTTDNR*LTTAGLTPAACPGRCGRACP 153 P T K ++ R + +A P ACP C ACP Sbjct: 20 PAWTLKKPSESVAQRAMCSARACPVACPVGCPAACP 55
>POLG_TBEVW (P14336) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3414 Score = 27.7 bits (60), Expect = 9.0 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = -3 Query: 158 DGGQARPHRPGQAAGVRPAVVSHLLSVVFSTLLCVDCGLILGMVIMNQHMAS 3 DG P G+A +PA+ +S+V +T+LC L V+MN+ +AS Sbjct: 2410 DGDVINPFGEGEA---KPALYERKMSLVLATVLC------LMSVVMNRTVAS 2452 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,737,302 Number of Sequences: 219361 Number of extensions: 381701 Number of successful extensions: 1160 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1160 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)