| Clone Name | rbart37b02 |
|---|---|
| Clone Library Name | barley_pub |
>PRS4_ORYSA (P46466) 26S protease regulatory subunit 4 homolog (TAT-binding| protein homolog 2) Length = 448 Score = 117 bits (292), Expect = 2e-26 Identities = 59/73 (80%), Positives = 62/73 (84%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT+KMTL+DDVNLEEFVMTKDEFSGADIKAICTE+GLLALRERRMKVTHADF Sbjct: 376 HTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVM 435 Query: 265 XXXKEGVPEGLYM 227 KEGVPEGLYM Sbjct: 436 FKKKEGVPEGLYM 448
>PRS4_CHICK (Q90732) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 96.7 bits (239), Expect = 2e-20 Identities = 45/73 (61%), Positives = 55/73 (75%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT++MTL+DDV L+E +M KD+ SGADIKAICTE+GL+ALRERRMKVT+ DF Sbjct: 368 HTSRMTLADDVTLDELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENFL 427 Query: 265 XXXKEGVPEGLYM 227 EG PEGLY+ Sbjct: 428 YKKTEGTPEGLYL 440
>PRS4_DROME (P48601) 26S protease regulatory subunit 4 (P26s4)| Length = 439 Score = 96.7 bits (239), Expect = 2e-20 Identities = 46/73 (63%), Positives = 56/73 (76%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT++MTL++DVNL E +M KD+ SGADIKAICTE+GL+ALRERRMKVT+ DF Sbjct: 367 HTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVL 426 Query: 265 XXXKEGVPEGLYM 227 KEG PEGLY+ Sbjct: 427 YRKKEGTPEGLYL 439
>PRS4_RAT (P62193) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 95.1 bits (235), Expect = 7e-20 Identities = 44/73 (60%), Positives = 56/73 (76%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT++MTL+DDV L++ +M KD+ SGADIKAICTE+GL+ALRERRMKVT+ DF Sbjct: 368 HTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVL 427 Query: 265 XXXKEGVPEGLYM 227 +EG PEGLY+ Sbjct: 428 YKKQEGTPEGLYL 440
>PRS4_MOUSE (P62192) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 95.1 bits (235), Expect = 7e-20 Identities = 44/73 (60%), Positives = 56/73 (76%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT++MTL+DDV L++ +M KD+ SGADIKAICTE+GL+ALRERRMKVT+ DF Sbjct: 368 HTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVL 427 Query: 265 XXXKEGVPEGLYM 227 +EG PEGLY+ Sbjct: 428 YKKQEGTPEGLYL 440
>PRS4_HUMAN (P62191) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 95.1 bits (235), Expect = 7e-20 Identities = 44/73 (60%), Positives = 56/73 (76%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT++MTL+DDV L++ +M KD+ SGADIKAICTE+GL+ALRERRMKVT+ DF Sbjct: 368 HTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVL 427 Query: 265 XXXKEGVPEGLYM 227 +EG PEGLY+ Sbjct: 428 YKKQEGTPEGLYL 440
>PRS4_CAEEL (O16368) Probable 26S protease regulatory subunit 4| Length = 443 Score = 90.5 bits (223), Expect = 2e-18 Identities = 45/73 (61%), Positives = 53/73 (72%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT++MTL +VNLEEF+ KDE SGADIKA+CTE+GLLALRERRM+VT DF Sbjct: 371 HTSRMTLGKEVNLEEFITAKDELSGADIKAMCTEAGLLALRERRMRVTMEDFQKSKENVL 430 Query: 265 XXXKEGVPEGLYM 227 KEG PE LY+ Sbjct: 431 YRKKEGAPEELYL 443
>PRS4_YEAST (P40327) 26S protease regulatory subunit 4 homolog (TAT-binding| homolog 5) Length = 437 Score = 83.6 bits (205), Expect = 2e-16 Identities = 43/73 (58%), Positives = 51/73 (69%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT+KM LS+DVNLE V TKD+ SGADI+A+CTE+GLLALRERRM+VT DF Sbjct: 365 HTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 424 Query: 265 XXXKEGVPEGLYM 227 E EGLY+ Sbjct: 425 KNKVEENLEGLYL 437
>PRS4_SCHPO (P36612) 26S protease regulatory subunit 4 homolog (Protein mts2)| Length = 448 Score = 75.9 bits (185), Expect = 4e-14 Identities = 38/70 (54%), Positives = 46/70 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT+KM L +DVNLEE + KD+ SGA+IKAI +E+GLLALRERRM+V DF Sbjct: 375 HTSKMNLGEDVNLEELIQCKDDLSGAEIKAIVSEAGLLALRERRMRVVMDDFRQAREKVL 434 Query: 265 XXXKEGVPEG 236 EG P G Sbjct: 435 KTKDEGGPAG 444
>PRS6A_ORYSA (P46465) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) Length = 429 Score = 61.6 bits (148), Expect = 8e-10 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM ++ DVN EE + D+F+GA +KA+C E+G+LALR +VTH DF Sbjct: 359 HSRKMNVNPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDF 410
>PSMR_ARCFU (O28303) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 398 Score = 61.6 bits (148), Expect = 8e-10 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT KM L++DV+ +E + SGADIKAICTE+G+ A+RE R KVT DF Sbjct: 324 HTRKMKLAEDVDFKELARITEGASGADIKAICTEAGMFAIREERAKVTMLDF 375
>PRS6A_LYCES (P54776) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) (Mg(2+)-dependent ATPase 1) (LEMA-1) Length = 423 Score = 61.6 bits (148), Expect = 8e-10 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM ++ DVN EE + D+F+GA +KA+C E+G+LALR +VTH DF Sbjct: 353 HSRKMNVNPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDF 404
>PRS6A_ARATH (O04019) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) Length = 419 Score = 59.3 bits (142), Expect = 4e-09 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM ++ DVN EE + D+F+GA +KA+C E+G+LALR +V H DF Sbjct: 349 HSRKMNVNADVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDF 400
>PRS6B_RAT (Q63570) 26S protease regulatory subunit 6B (TAT-binding protein 7)| (TBP-7) Length = 418 Score = 58.9 bits (141), Expect = 5e-09 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 T+KM LS++V+LE++V D+ SGADI +IC ESG+LA+RE R V DF Sbjct: 349 TSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDF 399
>PRS6B_HUMAN (P43686) 26S protease regulatory subunit 6B (MIP224)| (MB67-interacting protein) (TAT-binding protein 7) (TBP-7) Length = 418 Score = 58.9 bits (141), Expect = 5e-09 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 T+KM LS++V+LE++V D+ SGADI +IC ESG+LA+RE R V DF Sbjct: 349 TSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDF 399
>PRS6A_BRACM (O23894) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) Length = 424 Score = 58.9 bits (141), Expect = 5e-09 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM + DVN EE + D+F+GA +KA+C E+G+LALR +V H DF Sbjct: 354 HSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDF 405
>PRS6B_MANSE (P46507) 26S protease regulatory subunit 6B (ATPase MS73)| Length = 415 Score = 58.9 bits (141), Expect = 5e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 TAKM LS++V+LEEFV D SGADI AIC E+G+ A+RE R V DF Sbjct: 346 TAKMNLSEEVDLEEFVARPDRVSGADINAICQEAGMNAVRENRYIVLPKDF 396
>PR6AB_XENLA (O42586) 26S protease regulatory subunit 6A-B (TAT-binding protein| 10) (TBP-10) Length = 404 Score = 57.4 bits (137), Expect = 2e-08 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM +S DVN EE D+F+GA KA+C E+G++ALR ++TH D+ Sbjct: 334 HSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGIIALRRGATELTHEDY 385
>PRS6A_RAT (Q63569) 26S protease regulatory subunit 6A (TAT-binding protein 1)| (TBP-1) (Spermatogenic cell/sperm-associated TAT-binding protein homolog SATA) Length = 439 Score = 57.4 bits (137), Expect = 2e-08 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM +S DVN EE D+F+GA KA+C E+G++ALR ++TH D+ Sbjct: 369 HSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY 420
>PRS6A_HUMAN (P17980) 26S protease regulatory subunit 6A (TAT-binding protein 1)| (TBP-1) (Proteasome subunit P50) Length = 439 Score = 57.4 bits (137), Expect = 2e-08 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM +S DVN EE D+F+GA KA+C E+G++ALR ++TH D+ Sbjct: 369 HSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY 420
>PRS6A_YEAST (P33297) 26S protease regulatory subunit 6A (TAT-binding protein| homolog 1) (TBP-1) Length = 434 Score = 57.4 bits (137), Expect = 2e-08 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KMT DD+N +E + DEF+GA +KA+ E+G++ALR + V H DF Sbjct: 364 HSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDF 415
>PRS6A_SCHPO (O14126) 26S protease regulatory subunit 6A| Length = 438 Score = 57.0 bits (136), Expect = 2e-08 Identities = 22/52 (42%), Positives = 36/52 (69%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM + DD+N EE + DE++GA +K++C E+G++ALR+ K+ H F Sbjct: 368 HSRKMAIDDDINWEELARSTDEYNGAMLKSVCVEAGMIALRQGDTKINHEHF 419
>PSMR_METTH (O26824) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 410 Score = 57.0 bits (136), Expect = 2e-08 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT+ M L+++V++E D SGAD+KAICTE+G+ A+R+ R +VT ADF Sbjct: 334 HTSGMALAEEVDIELLARITDGASGADLKAICTEAGMFAIRDERDEVTMADF 385
>PSMR_METJA (Q58576) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 430 Score = 56.6 bits (135), Expect = 3e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT KM L++DVNLEE + GA++KAICTE+G+ A+RE R VT DF Sbjct: 353 HTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDF 404
>PRS6A_MOUSE (O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1)| (TBP-1) Length = 442 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H+ KM +S DVN EE D+F+GA KA+C E+G++ALR ++TH D Sbjct: 372 HSRKMNVSPDVNYEELARCTDDFNGAQSKAVCVEAGMIALRRGATELTHED 422
>PSMR_METKA (Q8TX03) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 436 Score = 55.8 bits (133), Expect = 5e-08 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT M L++DV+L++ + SGADIKAICTE+G++A+RE R VT DF Sbjct: 362 HTRDMNLAEDVDLQKLAKITEGASGADIKAICTEAGMMAIREDRDIVTMDDF 413
>PRS8_YEAST (Q01939) 26S protease regulatory subunit 8 homolog (SUG1 protein)| (CIM3 protein) (TAT-binding protein TBY1) Length = 405 Score = 55.5 bits (132), Expect = 6e-08 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + + SGAD+K +CTE+G+ ALRERR+ VT DF Sbjct: 331 HSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382
>PRS6B_DICDI (P34123) 26S protease regulatory subunit 6B homolog (TAT-binding| protein homolog 2) Length = 403 Score = 54.3 bits (129), Expect = 1e-07 Identities = 24/51 (47%), Positives = 38/51 (74%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 T+KM LSD+V+LE++V D+ SGA+I++IC E+G+ A+R+ R + DF Sbjct: 334 TSKMNLSDEVDLEDYVSRPDKLSGAEIQSICQEAGMHAIRKNRYVILPKDF 384
>PRS8_MANSE (P54814) 26S protease regulatory subunit 8 (18-56 protein)| Length = 402 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 328 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 379
>PRS8_RAT (P62198) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (Thyroid hormone receptor-interacting protein 1) (TRIP1) Length = 406 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 332 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_PIG (P62197) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (TAT-binding protein homolog 10) (TBP10) Length = 406 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 332 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_MOUSE (P62196) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (mSUG1) Length = 406 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 332 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_HUMAN (P62195) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (Thyroid hormone receptor-interacting protein 1) (TRIP1) Length = 406 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 332 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_BOVIN (P62194) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) Length = 406 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 332 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_XENLA (P46470) 26S protease regulatory subunit 8 (SUG1 homolog) (xSUG1)| Length = 461 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 326 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 377
>PRS8_DROME (O18413) 26S protease regulatory subunit 8| Length = 405 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 331 HSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF 382
>PRS8_DICDI (P34124) 26S protease regulatory subunit 8 (TAT-binding protein| homolog 10) (Fragment) Length = 389 Score = 53.1 bits (126), Expect = 3e-07 Identities = 24/52 (46%), Positives = 37/52 (71%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ KM L+ +NL++ + SGA++KA+CTE+G+ ALRERR+ V+ DF Sbjct: 315 HSRKMNLTRGINLKKISDKMNGASGAELKAVCTEAGMYALRERRVHVSQEDF 366
>PRS6B_CAEEL (P46502) Probable 26S protease regulatory subunit 6B| Length = 414 Score = 52.8 bits (125), Expect = 4e-07 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = -2 Query: 439 AKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 ++M LSDDV+LE++V D+ SGADI +IC E+G+ A+RE R V D Sbjct: 346 SRMNLSDDVDLEDWVARPDKISGADINSICQEAGMQAVRENRYVVLTKD 394
>PRS6B_ARATH (Q9SEI4) 26S protease regulatory subunit 6B homolog (26S proteasome| AAA-ATPase subunit RPT3) (Regulatory particle triple-A ATPase subunit 3) Length = 408 Score = 52.0 bits (123), Expect = 7e-07 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 T+KM LSD+V+LE++V D+ S A+I AIC E+G+ A+R+ R + DF Sbjct: 339 TSKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF 389
>PRS6B_MOUSE (P54775) 26S protease regulatory subunit 6B (MIP224)| (MB67-interacting protein) (TAT-binding protein 7) (TBP-7) (CIP21) Length = 418 Score = 52.0 bits (123), Expect = 7e-07 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 T+KM LS++V+LE++V D+ SGADI +IC G+LA+RE V DF Sbjct: 349 TSKMNLSEEVDLEDYVARPDKISGADINSICQARGMLAVRETAYIVLAKDF 399
>PSMR2_HALSA (Q9HRW6) Proteasome-activating nucleotidase 2 (Proteasome| regulatory subunit 2) Length = 407 Score = 51.6 bits (122), Expect = 9e-07 Identities = 23/52 (44%), Positives = 33/52 (63%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT M ++D V+ E + SGAD+KAICTE+G+ A+R+ R +V DF Sbjct: 332 HTRAMNVADSVDFGELAADTGDLSGADVKAICTEAGMFAIRDDRTEVRMQDF 383
>PRS6B_SOLTU (P54778) 26S protease regulatory subunit 6B homolog| Length = 413 Score = 51.6 bits (122), Expect = 9e-07 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 TAKM L D+V+LE++V D+ S A+I AIC E+G+ A+R+ R + DF Sbjct: 344 TAKMNLGDEVDLEDYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDF 394
>PRS6B_ENCCU (Q8SQI9) 26S protease regulatory subunit 6B homolog| Length = 387 Score = 51.2 bits (121), Expect = 1e-06 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 T+KM+L+D V++E V ++ S ADI +IC E+G+LA+R R VT DF Sbjct: 318 TSKMSLNDSVDIESLVCRPEKISCADINSICQEAGMLAVRASRYMVTQRDF 368
>PRS8_NAEFO (Q25544) 26S protease regulatory subunit 8 homolog (TAT-binding| protein homolog) Length = 414 Score = 50.8 bits (120), Expect = 1e-06 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H+ +M L+ +NL + SGA+IKA CTE+G+ ALRERR+ VT D Sbjct: 340 HSRRMNLTRGINLRKIASMLGGASGAEIKATCTEAGMFALRERRVHVTQED 390
>PRS8_SCHPO (P41836) 26S protease regulatory subunit 8 homolog (Protein let1)| Length = 403 Score = 50.4 bits (119), Expect = 2e-06 Identities = 22/52 (42%), Positives = 34/52 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ M L+ ++L+ + SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 329 HSRSMNLTRGIDLKSIAEKMNGASGAELKGVCTEAGMFALRERRVHVTQEDF 380
>Y1156_METJA (Q58556) Cell division cycle protein 48 homolog MJ1156| Length = 903 Score = 49.7 bits (117), Expect = 3e-06 Identities = 21/42 (50%), Positives = 31/42 (73%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 HT M L++DVNLEE + ++GADI+A+C E+ +LA+RE Sbjct: 633 HTRSMNLAEDVNLEELAKKTEGYTGADIEALCREAAMLAVRE 674 Score = 37.4 bits (85), Expect = 0.017 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 HT M L++DV+L+ F GAD+ A+C E+ + ALR Sbjct: 359 HTRNMPLAEDVDLDYLADVTHGFVGADLAALCKEAAMRALR 399
>Y1297_ARCFU (O28972) Cell division cycle protein 48 homolog AF1297| Length = 733 Score = 48.5 bits (114), Expect = 7e-06 Identities = 21/42 (50%), Positives = 30/42 (71%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 H L+DDVN+EE + +SGADI+A+C E+G+LA+RE Sbjct: 636 HLRGKPLADDVNIEELAEKTEGYSGADIEAVCREAGMLAIRE 677 Score = 44.3 bits (103), Expect = 1e-04 Identities = 20/41 (48%), Positives = 29/41 (70%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 HT KM L++DV+LEE + F GAD++A+C E+ + ALR Sbjct: 362 HTRKMPLAEDVDLEELAELTNGFVGADLEALCKEAAMHALR 402
>PSMR_SULSO (Q980M1) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 393 Score = 47.4 bits (111), Expect = 2e-05 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 KM + D++NLE + FSGADIK +C E+ +A+R+ R KVT D Sbjct: 320 KMKIEDNINLELLSQLTEGFSGADIKNVCVEAAYMAIRDGRNKVTMND 367
>PRS6B_SCHPO (O74894) 26S protease regulatory subunit 6B homolog| Length = 389 Score = 47.4 bits (111), Expect = 2e-05 Identities = 24/50 (48%), Positives = 34/50 (68%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 TAKM LS +V+L+ F+M D SGA I AI ++GLLA+R+ R + +D Sbjct: 319 TAKMLLSPEVDLDTFIMRPDASSGAQIAAIMQDAGLLAVRKSRGVILQSD 368
>PSMR_METAC (Q8TI88) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 421 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/52 (40%), Positives = 33/52 (63%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H KMTL+ D++ ++ + SGAD+KAI TE+G+ A+R+ + V DF Sbjct: 342 HCGKMTLAGDIDFKKLAKVTEGMSGADLKAIATEAGMFAVRKDKALVEMEDF 393
>PSMR_PYRAB (Q9V287) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 399 Score = 46.6 bits (109), Expect = 3e-05 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT +M L + V+L + SGAD+KAI TE+G+ A+RERR VT DF Sbjct: 323 HTRRMKLKN-VDLRVIAEITEGASGADLKAIATEAGMFAIRERRTYVTQEDF 373
>CD48B_ARATH (Q9ZPR1) Cell division control protein 48 homolog B (AtCDC48b)| Length = 603 Score = 46.6 bits (109), Expect = 3e-05 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 HT MTL DDV+L + D F+GA+++ +C ESG ++LRE Sbjct: 470 HTRNMTLGDDVDLRKIAEETDLFTGAELEGLCRESGTVSLRE 511 Score = 32.0 bits (71), Expect = 0.71 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 2/109 (1%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER--RMKVTHADFXXXXXX 272 +T K+ L V+L+ ++ + + GAD++A+C E+ + A + + +T DF Sbjct: 208 YTKKVNLDPSVDLQAIAISCNGYVGADLEALCREATISASKRSSDSLILTSQDFKIAKSV 267 Query: 271 XXXXXKEGVPEGLYM**IVHRSSLPEQHCVVIIYLVSWDIFPGLEDRRK 125 G+ V I V+WD GL+D +K Sbjct: 268 VGPSINRGI--------------------TVEIPKVTWDDVGGLKDLKK 296
>PRS7_PRUPE (O64982) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1) (Regulatory particle triple-A ATPase subunit 1) Length = 425 Score = 46.2 bits (108), Expect = 4e-05 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT M D+ E +GADI+++CTE+G+ A+R RR VT DF Sbjct: 350 HTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDF 401
>PRS7_SPIOL (Q41365) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1) (Regulatory particle triple-A ATPase subunit 1) Length = 426 Score = 46.2 bits (108), Expect = 4e-05 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT M D+ E +GADI+++CTE+G+ A+R RR VT DF Sbjct: 351 HTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDF 402
>PRS7_ORYSA (Q9FXT9) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1) (Regulatory particle triple-A ATPase subunit 1) Length = 426 Score = 46.2 bits (108), Expect = 4e-05 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT M D+ E +GADI+++CTE+G+ A+R RR VT DF Sbjct: 351 HTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDF 402
>PRS7_ARATH (Q9SSB5) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1a) (Regulatory particle triple-A ATPase subunit 1a) Length = 426 Score = 46.2 bits (108), Expect = 4e-05 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT M D+ E +GADI+++CTE+G+ A+R RR VT DF Sbjct: 351 HTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDF 402
>PSMR_PYRHO (O57940) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 399 Score = 46.2 bits (108), Expect = 4e-05 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT +M L V+L + SGAD+KAI TE+G+ A+RERR VT DF Sbjct: 323 HTRRMKLKG-VDLRAIAEMTEGASGADLKAIATEAGMFAIRERRTYVTQEDF 373
>PSMR_METMP (Q6LWR0) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 407 Score = 45.8 bits (107), Expect = 5e-05 Identities = 23/52 (44%), Positives = 31/52 (59%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT KM L V+L E + GAD+KA+CTE+G+ A+RE R + DF Sbjct: 331 HTEKMNLKG-VDLREVAKIAENMVGADLKAVCTEAGMFAIREEREFIKMDDF 381
>PSMR_PYRKO (Q5JHS5) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 397 Score = 45.8 bits (107), Expect = 5e-05 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT KM L V+L + SGAD+KAI TE+G+ A+R+RR VT DF Sbjct: 321 HTRKMNLKG-VDLRVIAEITEGASGADLKAIATEAGMFAIRDRRTYVTQDDF 371
>PSMR_METMA (Q8PY58) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 420 Score = 45.4 bits (106), Expect = 6e-05 Identities = 20/52 (38%), Positives = 33/52 (63%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H KMTL++D++ ++ + SGAD+KAI TE+G+ A+R + V +F Sbjct: 342 HCEKMTLAEDIDFKKLAKATEGMSGADLKAIATEAGMFAVRRDKELVEMEEF 393
>PSMR_PYRFU (Q8U4H3) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 396 Score = 45.1 bits (105), Expect = 8e-05 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 HT +M L V+L + SGAD+KAI TE+G+ A+RERR VT DF Sbjct: 320 HTRRMKLRG-VDLRLIAELTEGASGADLKAIATEAGMFAIRERRTYVTQEDF 370
>PRS10_CAEEL (O17071) Probable 26S protease regulatory subunit S10B (Proteasome| regulatory particle ATPase-like protein 4) Length = 406 Score = 45.1 bits (105), Expect = 8e-05 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ K+T +++ E V D FS AD++ +CTE+G+ A+R R V DF Sbjct: 333 HSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDF 384
>CDC48_SOYBN (P54774) Cell division cycle protein 48 homolog (Valosin-containing| protein homolog) (VCP) Length = 807 Score = 44.7 bits (104), Expect = 1e-04 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M LSDDV+LE + GAD+ A+CTE+ L +RE+ Sbjct: 388 HTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREK 430
>PRS7_XENLA (P46472) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 433 Score = 42.7 bits (99), Expect = 4e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H M++ D+ E +GA+I+++CTE+G+ A+R RR T DF Sbjct: 358 HARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDF 409
>PSMR1_HALSA (Q9HNP9) Proteasome-activating nucleotidase 1 (Proteasome| regulatory subunit 1) Length = 411 Score = 42.7 bits (99), Expect = 4e-04 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H +M ++D V+ + EFSGA + ++ TE+G+ A+R+ R +V DF Sbjct: 335 HAGEMNVADSVDFSDLAADTAEFSGAQLASLATEAGMFAIRDDRDEVHRQDF 386
>PRS7_RAT (Q63347) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 432 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H M++ D+ E +GA+I+++CTE+G+ A+R RR T DF Sbjct: 357 HARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDF 408
>PRS7_MOUSE (P46471) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 432 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H M++ D+ E +GA+I+++CTE+G+ A+R RR T DF Sbjct: 357 HARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDF 408
>PRS7_HUMAN (P35998) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 432 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H M++ D+ E +GA+I+++CTE+G+ A+R RR T DF Sbjct: 357 HARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDF 408
>PRS10_SPETR (P62335) 26S protease regulatory subunit S10B (Proteasome subunit| p42) (Proteasome 26S subunit ATPase 6) (Conserved ATPase domain protein 44) (CADp44) Length = 389 Score = 42.0 bits (97), Expect = 7e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H +T +++ E V D F+GAD++ +CTE+G+ A+R V DF Sbjct: 316 HAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDF 367
>PRS10_MOUSE (P62334) 26S protease regulatory subunit S10B (Proteasome subunit| p42) (Proteasome 26S subunit ATPase 6) Length = 389 Score = 42.0 bits (97), Expect = 7e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H +T +++ E V D F+GAD++ +CTE+G+ A+R V DF Sbjct: 316 HAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDF 367
>PRS10_HUMAN (P62333) 26S protease regulatory subunit S10B (Proteasome subunit| p42) (Proteasome 26S subunit ATPase 6) Length = 389 Score = 42.0 bits (97), Expect = 7e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H +T +++ E V D F+GAD++ +CTE+G+ A+R V DF Sbjct: 316 HAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDF 367
>TERA_XENLA (P23787) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) Length = 805 Score = 41.6 bits (96), Expect = 0.001 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M LSDDV+LE+ GAD+ A+C+E+ L A+R++ Sbjct: 384 HTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKK 426 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K ++ DV+++ + FSGAD+ IC + LA+RE Sbjct: 663 KSPVAKDVDVDFLAKMTNGFSGADLTEICQRACKLAIRE 701
>PRS7_CAEEL (Q18787) Probable 26S protease regulatory subunit 7| Length = 435 Score = 41.6 bits (96), Expect = 0.001 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H +M++ D+ + +GA+I+++CTE+G+ A+R RR T DF Sbjct: 360 HAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDF 411
>PRS7_SCHPO (O42931) 26S protease regulatory subunit 7 homolog| Length = 438 Score = 41.2 bits (95), Expect = 0.001 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H M + D+ E +GA+++++CTE+G+ A+R RR T DF Sbjct: 362 HAKSMAIDKDIRWELIARLCPSQTGAELRSVCTEAGMFAIRARRRVATEKDF 413
>CD48E_ARATH (Q9LZF6) Cell division control protein 48 homolog E (AtCDC48e)| (Transitional endoplasmic reticulum ATPase E) Length = 810 Score = 41.2 bits (95), Expect = 0.001 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L++DV+LE + GAD+ A+CTE+ L +RE+ Sbjct: 387 HTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREK 429
>TERA1_CAEEL (P54811) Transitional endoplasmic reticulum ATPase homolog 1| (p97/CDC48 homolog 1) Length = 809 Score = 41.2 bits (95), Expect = 0.001 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+DDV+LE+ F GAD+ ++C+E+ L +RE+ Sbjct: 390 HTKNMKLADDVDLEQIANECHGFVGADLASLCSEAALQQIREK 432 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K LS D++L FSGAD+ IC + LA+RE Sbjct: 670 KTPLSKDLDLTFLAKNTVGFSGADLTEICQRACKLAIRE 708
>CD48A_ARATH (P54609) Cell division control protein 48 homolog A (AtCDC48a)| Length = 809 Score = 41.2 bits (95), Expect = 0.001 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L++DV+LE + GAD+ A+CTE+ L +RE+ Sbjct: 387 HTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREK 429
>CD48D_ARATH (Q9SCN8) Putative cell division control protein 48 homolog D| (AtCDC48d) (Transitional endoplasmic reticulum ATPase D) Length = 815 Score = 41.2 bits (95), Expect = 0.001 Identities = 29/107 (27%), Positives = 48/107 (44%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXX 266 HT M L++DV+LE + GAD+ A+CTE+ L +RE K+ D Sbjct: 388 HTKNMKLAEDVDLERVSKDTHGYVGADLAALCTEAALQCIRE---KMDVIDLDDEEIDAE 444 Query: 265 XXXKEGVPEGLYM**IVHRSSLPEQHCVVIIYLVSWDIFPGLEDRRK 125 V + + + + + VV + VSW+ GLE+ ++ Sbjct: 445 ILNSMAVSNDHFQTALGNSNPSALRETVVEVPNVSWEDIGGLENVKR 491 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K ++ DV+L FSGADI IC S A+RE Sbjct: 667 KSPVAKDVDLRALAKYTQGFSGADITEICQRSCKYAIRE 705
>PSMR_AERPE (Q9YAC7) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 409 Score = 41.2 bits (95), Expect = 0.001 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 HT K ++ DV+LE + FSGAD+KA+ E+G A+R +T D Sbjct: 322 HTRKAKMAPDVDLEAIAKLTEGFSGADLKAVVVEAGYNAIRRGSRVITMDD 372
>TERA_RAT (P46462) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+DDV+LE+ GAD+ A+C+E+ L A+R++ Sbjct: 383 HTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKK 425 Score = 32.0 bits (71), Expect = 0.71 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K ++ DV+LE + FSGAD+ IC + LA+RE Sbjct: 662 KSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRE 700
>TERA_PIG (P03974) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+DDV+LE+ GAD+ A+C+E+ L A+R++ Sbjct: 383 HTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKK 425 Score = 32.0 bits (71), Expect = 0.71 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K ++ DV+LE + FSGAD+ IC + LA+RE Sbjct: 662 KSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRE 700
>TERA_MOUSE (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+DDV+LE+ GAD+ A+C+E+ L A+R++ Sbjct: 383 HTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKK 425 Score = 32.0 bits (71), Expect = 0.71 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K ++ DV+LE + FSGAD+ IC + LA+RE Sbjct: 662 KSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRE 700
>TERA_HUMAN (P55072) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+DDV+LE+ GAD+ A+C+E+ L A+R++ Sbjct: 383 HTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKK 425 Score = 32.0 bits (71), Expect = 0.71 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K ++ DV+LE + FSGAD+ IC + LA+RE Sbjct: 662 KSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRE 700
>KTNA1_XENLA (Q9PUL2) Katanin p60 ATPase-containing subunit (EC 3.6.4.3)| (Katanin p60 subunit) (p60 katanin) (Fragment) Length = 486 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/40 (42%), Positives = 27/40 (67%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L+DDVN+E D +SGADI +C ++ L+A+R R Sbjct: 394 ELELADDVNIECIAENMDGYSGADITNVCRDASLMAMRRR 433
>CDC48_YEAST (P25694) Cell division control protein 48| Length = 835 Score = 40.0 bits (92), Expect = 0.003 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+DDV+LE + GADI ++C+E+ + +RE+ Sbjct: 394 HTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436
>CDC48_CAPAN (Q96372) Cell division cycle protein 48 homolog| Length = 805 Score = 39.7 bits (91), Expect = 0.003 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+++V+LE + GAD+ A+CTE+ L +RE+ Sbjct: 388 HTKNMKLAEEVDLERISKDTHGYVGADLAALCTEAALQCIREK 430 Score = 30.4 bits (67), Expect = 2.1 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K LS D++L FSGAD+ IC + A+RE Sbjct: 667 KSPLSKDIDLRALAKHTQGFSGADVTEICQRACKYAIRE 705
>PRS6B_YEAST (P33298) 26S protease regulatory subunit 6B homolog (YNT1 protein)| (TAT-binding homolog 2) Length = 428 Score = 39.3 bits (90), Expect = 0.004 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = -2 Query: 439 AKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 +KM+L+ + +L+ ++ D SGA I AI E+GL A+R+ R + +D Sbjct: 358 SKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSD 406
>PRS10_YEAST (P53549) 26S protease subunit RPT4 (26S protease subunit SUG2)| (Proteasomal cap subunit) Length = 437 Score = 39.3 bits (90), Expect = 0.004 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 HTAK+ + + + E V D F+GADI+ TE+G A+R+ R + D Sbjct: 364 HTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDD 414
>CDC48_SCHPO (Q9P3A7) Cell division cycle protein 48| Length = 815 Score = 39.3 bits (90), Expect = 0.004 Identities = 15/43 (34%), Positives = 28/43 (65%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L+DDV+LE+ + G+D+ ++C+E+ + +RE+ Sbjct: 404 HTKNMKLADDVDLEQIAAETHGYVGSDLASLCSEAAMQQIREK 446
>KTNA1_RAT (Q6E0V2) Katanin p60 ATPase-containing subunit A1 (EC 3.6.4.3)| (Katanin p60 subunit A1) (p60 katanin) Length = 491 Score = 38.9 bits (89), Expect = 0.006 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L+DDVNL + +SGADI +C ++ L+A+R R Sbjct: 397 ELELADDVNLASIAENMEGYSGADITNVCRDASLMAMRRR 436
>KTNA1_MOUSE (Q9WV86) Katanin p60 ATPase-containing subunit A1 (EC 3.6.4.3)| (Katanin p60 subunit A1) (p60 katanin) (Lipotransin) Length = 491 Score = 38.9 bits (89), Expect = 0.006 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L+DDVNL + +SGADI +C ++ L+A+R R Sbjct: 397 ELELADDVNLASIAENMEGYSGADITNVCRDASLMAMRRR 436
>PRS6B_ASPNG (P78578) 26S protease regulatory subunit 6B homolog| Length = 423 Score = 38.5 bits (88), Expect = 0.008 Identities = 18/45 (40%), Positives = 30/45 (66%) Frame = -2 Query: 439 AKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKV 305 +KM+LS +V+L+ ++ + SGA I AI E+GL A+R+ R + Sbjct: 352 SKMSLSPEVDLDSLIVRNEPLSGAVIAAIMQEAGLRAVRKNRYNI 396
>VAT_THEAC (O05209) VCP-like ATPase| Length = 745 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 HT M L+ DV+L + + + GAD++ +C E+G+ A RE Sbjct: 648 HTKNMPLAPDVDLNDIAQRTEGYVGADLENLCREAGMNAYRE 689
>PRS7_YEAST (P33299) 26S protease regulatory subunit 7 homolog (CIM5 protein)| (TAT-binding homolog 3) Length = 467 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H+ M++ + E +GA+++++CTE+G+ A+R RR T DF Sbjct: 392 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 443
>TERA2_CAEEL (P54812) Transitional endoplasmic reticulum ATPase homolog 2| (p97/CDC48 homolog 2) Length = 810 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT M L +DV+LE+ F GAD+ ++C+E+ + +RE+ Sbjct: 389 HTKNMKLGEDVDLEQVANECHGFVGADLASLCSEAAIQQIREK 431 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 K LS D++L FSGAD+ IC + LA+RE Sbjct: 668 KTPLSADLDLNFLAKNTVGFSGADLTEICQRACKLAIRE 706
>FTSH_BACSU (P37476) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 637 Score = 37.4 bits (85), Expect = 0.017 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H L + VNL+ M FSGAD++ + E+ L+A R+ + K+ D Sbjct: 343 HARNKPLDETVNLKSIAMRTPGFSGADLENLLNEAALVAARQNKKKIDARD 393
>KTNA1_STRPU (O61577) Katanin p60 ATPase-containing subunit (EC 3.6.4.3)| (Katanin p60 subunit) (p60 katanin) Length = 516 Score = 37.4 bits (85), Expect = 0.017 Identities = 14/40 (35%), Positives = 27/40 (67%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L+DD++L+ D +SGADI +C ++ ++A+R R Sbjct: 422 EVPLADDIDLKSIAEKMDGYSGADITNVCRDASMMAMRRR 461
>FTSH3_SYNY3 (P73437) Cell division protein ftsH homolog 3 (EC 3.4.24.-)| Length = 628 Score = 37.0 bits (84), Expect = 0.022 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 + K+ L +V L+ F+GAD+ + E+ LLA R ++ VT ADF Sbjct: 358 YAKKIKLDKEVELKNIATRTPGFAGADLANLVNEAALLAARNKQDSVTEADF 409
>CDCH_HALSA (Q9HPF0) Protein cdcH| Length = 742 Score = 37.0 bits (84), Expect = 0.022 Identities = 19/41 (46%), Positives = 24/41 (58%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 HT M LSDDVNL F GADI+++ E+ + ALR Sbjct: 369 HTRGMPLSDDVNLSTLADDTHGFVGADIESLSKEAAMRALR 409 Score = 30.8 bits (68), Expect = 1.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 HT L+ DV+L E D + G+D+ I E+ + ALR+ Sbjct: 643 HTQDTPLAADVSLRELAERADGYVGSDLANIAREAAIEALRD 684
>PSMR_SULTO (Q975U2) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 392 Score = 37.0 bits (84), Expect = 0.022 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 KM ++ + + FSGA+IK +CTE+G +A+R R V D Sbjct: 320 KMKTDGNIRYDILASMTEGFSGAEIKNVCTEAGYIAIRNGRKYVNMTD 367
>KTNA1_HUMAN (O75449) Katanin p60 ATPase-containing subunit A1 (EC 3.6.4.3)| (Katanin p60 subunit A1) (p60 katanin) Length = 491 Score = 37.0 bits (84), Expect = 0.022 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L+DDV+L + +SGADI +C ++ L+A+R R Sbjct: 397 ELELADDVDLASIAENMEGYSGADITNVCRDASLMAMRRR 436
>FTSH_BACPF (P94304) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 679 Score = 36.6 bits (83), Expect = 0.029 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H L+DDVNL+ FSGAD++ + E+ L+A R K++ Sbjct: 348 HARNKPLNDDVNLKTIATRTPGFSGADLENLLNEAALVAARHDHTKIS 395
>PRS10_SCHPO (O74445) Probable 26S protease subunit rpt4| Length = 388 Score = 36.6 bits (83), Expect = 0.029 Identities = 16/51 (31%), Positives = 30/51 (58%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H K++ +++ E V D +GAD++ + TE+G +A++E R V +D Sbjct: 315 HLEKVSKQGEIDYEALVKLTDGTNGADLRNVVTEAGFIAIKEDRDYVIQSD 365
>KATL1_RAT (Q5XIK7) Katanin p60 ATPase-containing subunit A-like 1 (EC| 3.6.4.3) (Katanin p60 subunit A-like 1) (p60 katanin-like 1) Length = 488 Score = 36.2 bits (82), Expect = 0.038 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L D++LE+ + +SGADI IC ++ L+A+R R Sbjct: 394 EVELDPDIHLEDIAEKTEGYSGADITNICRDASLMAMRRR 433
>KATL1_MOUSE (Q8K0T4) Katanin p60 ATPase-containing subunit A-like 1 (EC| 3.6.4.3) (Katanin p60 subunit A-like 1) (p60 katanin-like 1) Length = 488 Score = 36.2 bits (82), Expect = 0.038 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L DV+LE+ + +SGADI IC ++ L+A+R R Sbjct: 394 EVELDPDVHLEDIADKTEGYSGADITNICRDASLMAMRRR 433
>SAV_SULAC (Q07590) SAV protein| Length = 780 Score = 35.4 bits (80), Expect = 0.065 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 HT M ++DDV+L++ ++GAD+ A+ E+ + ALR Sbjct: 392 HTRNMPITDDVDLDKLAEMTYGYTGADLAALAKEAAIYALR 432 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/41 (34%), Positives = 28/41 (68%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 HT + L++DV+LE+ + ++GAD++A+ E+ + A+R Sbjct: 668 HTKNVPLAEDVSLEDIAEKAEGYTGADLEALVREATINAMR 708
>KATL1_HUMAN (Q9BW62) Katanin p60 ATPase-containing subunit A-like 1 (EC| 3.6.4.3) (Katanin p60 subunit A-like 1) (p60 katanin-like 1) Length = 490 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 ++ L D+ LE+ + +SGADI +C ++ L+A+R R Sbjct: 396 EVELDPDIQLEDIAEKIEGYSGADITNVCRDASLMAMRRR 435
>SEC18_CANAL (P34732) Vesicular-fusion protein SEC18| Length = 794 Score = 34.3 bits (77), Expect = 0.14 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 19/71 (26%) Frame = -2 Query: 445 HTAKMT----LSDDVNLEEFVMTKDEFSGADIKAIC-----------TESGLLALRE--- 320 HT K+T LS DVN +E F+GA+I+ +C T+ G LA + Sbjct: 468 HTKKLTENGILSSDVNFDELSTLTKNFTGAEIEGLCNSAKSYAISRHTKKGALAQIDPES 527 Query: 319 -RRMKVTHADF 290 +MK+T DF Sbjct: 528 IAKMKITRDDF 538
>RIX7_YEAST (Q07844) Ribosome biogenesis ATPase RIX7| Length = 837 Score = 34.3 bits (77), Expect = 0.14 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = -2 Query: 427 LSDDVNLEEFVMTK--DEFSGADIKAICTESGLLALRER 317 LS DV+ EE + + + FSGAD+ A+ ES +LAL+ + Sbjct: 721 LSSDVDFEEIIRNEKCNNFSGADLAALVRESSVLALKRK 759
>ATAD2_PONPY (Q5RDX4) ATPase family AAA domain-containing protein 2| Length = 1091 Score = 33.5 bits (75), Expect = 0.25 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 418 DVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 D LEE + GADIK+IC E+ L ALR R Sbjct: 452 DTFLEELAENCVGYRGADIKSICAEAALCALRRR 485
>FTSH4_SYNY3 (P72991) Cell division protein ftsH homolog 4 (EC 3.4.24.-)| Length = 616 Score = 33.5 bits (75), Expect = 0.25 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H TLS DV+L++ F+GAD+ + E+ +LA R +++ Sbjct: 343 HARGKTLSQDVDLDKIARRTPGFTGADLSNLLNEAAILAARRNLTEIS 390
>FTSH_AQUAE (O67077) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 634 Score = 33.5 bits (75), Expect = 0.25 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H L+ DV+LE F+GAD++ + E+ LLA R+ + ++T Sbjct: 338 HARNKKLAKDVDLEFVARATPGFTGADLENLLNEAALLAARKGKEEIT 385
>FTSH_TREPA (O83746) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 609 Score = 33.5 bits (75), Expect = 0.25 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H + L+ +V+L+ +SGAD+ + E+ LLA+R R +V D Sbjct: 322 HAQNVKLAPEVDLKAVARITGGYSGADLANVVNEAALLAVRSGRAQVIETD 372
>ATAD2_HUMAN (Q6PL18) ATPase family AAA domain-containing protein 2| Length = 1390 Score = 33.5 bits (75), Expect = 0.25 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 418 DVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 D LEE + GADIK+IC E+ L ALR R Sbjct: 621 DTFLEELAENCVGYCGADIKSICAEAALCALRRR 654
>FTSH_ODOSI (P49825) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 644 Score = 33.1 bits (74), Expect = 0.32 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H L +DV+L + FSGAD+ + E+ +LA R ++ +T Sbjct: 368 HARNKPLGEDVSLVQLANRTPGFSGADLANLLNEAAILATRYKKSSIT 415
>ATAD2_MOUSE (Q8CDM1) ATPase family AAA domain-containing protein 2| Length = 1040 Score = 33.1 bits (74), Expect = 0.32 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -2 Query: 418 DVNLEEFVMTKDEFSGADIKAICTESGLLALRER 317 D+ LEE + GADIK+IC E+ L ALR R Sbjct: 276 DMFLEELAEHCVGYCGADIKSICAEAALCALRRR 309
>PEX1_HUMAN (O43933) Peroxisome biogenesis factor 1 (Peroxin-1) (Peroxisome| biogenesis disorder protein 1) Length = 1283 Score = 32.7 bits (73), Expect = 0.42 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -2 Query: 433 MTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLAL 326 + L+DDV+L+ D F+GAD+KA+ + L AL Sbjct: 1024 LPLADDVDLQHVASVTDSFTGADLKALLYNAQLEAL 1059
>FTSH_CYACA (O19922) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 614 Score = 32.7 bits (73), Expect = 0.42 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H+ K + DV LE FSGAD+ + E+ +L +R ++++T Sbjct: 353 HSKKKKIHKDVLLEVIARRTPGFSGADLANLLNEAAILTVRRGKVEIT 400
>ATAD1_RAT (Q505J9) ATPase family AAA domain-containing protein 1| Length = 361 Score = 32.3 bits (72), Expect = 0.55 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 415 VNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 V+L E D FSG+D+K +C ++ LL +RE Sbjct: 282 VDLLEVAQETDGFSGSDLKEMCRDAALLCVRE 313
>ATAD1_MOUSE (Q9D5T0) ATPase family AAA domain-containing protein 1| Length = 361 Score = 32.3 bits (72), Expect = 0.55 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 415 VNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 V+L E D FSG+D+K +C ++ LL +RE Sbjct: 282 VDLLEVAQETDGFSGSDLKEMCRDAALLCVRE 313
>ATAD1_HUMAN (Q8NBU5) ATPase family AAA domain-containing protein 1| Length = 361 Score = 32.3 bits (72), Expect = 0.55 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 415 VNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 V+L E D FSG+D+K +C ++ LL +RE Sbjct: 282 VDLLEVAQETDGFSGSDLKEMCRDAALLCVRE 313
>FTSH_HELPY (P71408) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 632 Score = 32.3 bits (72), Expect = 0.55 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKV 305 H + L++DVNL+E +GAD+ I E+ LLA R + +V Sbjct: 354 HIKGVKLANDVNLQEVAKLTAGLAGADLANIINEAALLAGRNNQKEV 400
>FTSH_HELPJ (Q9ZM66) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 632 Score = 32.3 bits (72), Expect = 0.55 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKV 305 H + L++DVNL+E +GAD+ I E+ LLA R + +V Sbjct: 354 HIKGVKLANDVNLQEVAKLTAGLAGADLANIINEAALLAGRNNQKEV 400
>ATD1A_BRARE (Q7ZZ25) ATPase family AAA domain-containing protein 1-A| Length = 380 Score = 32.0 bits (71), Expect = 0.71 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = -2 Query: 427 LSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 LS+ +NL+E + +SG+D+K +C ++ + +R+ Sbjct: 281 LSNAINLKEIASQSEGYSGSDLKELCRDAAMYRVRD 316
>CDAT_PLAF7 (P46468) Putative cell division cycle ATPase| Length = 1229 Score = 31.6 bits (70), Expect = 0.93 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 T KM L DVNL + + GAD+ +C E+ + ++E Sbjct: 708 TKKMKLDPDVNLRKIAKECHGYVGADLAQLCFEAAIQCIKE 748
>FTSH_HELFE (O32617) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 638 Score = 31.2 bits (69), Expect = 1.2 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKV 305 H + L++DV+L+E +GAD+ I E+ LLA R + +V Sbjct: 360 HIKPVKLANDVDLQEIAKLTAGLAGADLANIINEAALLAGRNNQKEV 406
>FTSH1_SYNY3 (Q55700) Cell division protein ftsH homolog 1 (EC 3.4.24.-)| Length = 627 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H L+ +V+++ FSGAD+ + E+ +L R R+ +T Sbjct: 354 HARNKKLAPEVSIDSIARRTPGFSGADLANLLNEAAILTARRRKSAIT 401
>FTSH_MYCPN (P75120) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 709 Score = 30.8 bits (68), Expect = 1.6 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H LS ++L + FSGA ++ + E+ LLA+R+ R + D Sbjct: 410 HAKNKNLSSKISLLDVAKRTPGFSGAQLENVINEATLLAVRDNRTTINMND 460
>FTSH2_HAEIN (P45219) Cell division protein ftsH homolog 2 (EC 3.4.24.-)| Length = 381 Score = 30.8 bits (68), Expect = 1.6 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H K++++ DV+ +SGAD+ + E+ L A R + VT +F Sbjct: 79 HMRKVSVAQDVDAMTLARGTPGYSGADLANLVNEAALFAARVNKRTVTMLEF 130
>KPK2_PLAFK (Q02595) Probable serine/threonine-protein kinase 2 (EC 2.7.11.1)| Length = 510 Score = 30.8 bits (68), Expect = 1.6 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +3 Query: 69 YNKLFNYPTIQA-------KKRLQTNLRLSSKPG-NISHDTKYIITTQCCSGSEDRCT 218 +N L YP + KK ++ ++ ++K N S K II CC +DRCT Sbjct: 297 FNILCGYPPFRGNNVKEIFKKNMRCHISFNTKHWINKSESVKEIILWMCCKNPDDRCT 354
>FTSH1_HAEIN (P71377) Cell division protein ftsH homolog 1 (EC 3.4.24.-)| Length = 635 Score = 30.8 bits (68), Expect = 1.6 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H K++++ DV+ +SGAD+ + E+ L A R + VT +F Sbjct: 333 HMRKVSVAQDVDAMTLARGTPGYSGADLANLVNEAALFAARVNKRTVTMLEF 384
>FTSH_PORPU (P51327) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 628 Score = 30.4 bits (67), Expect = 2.1 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H + V+LE FSGAD+ + E+ +L R R+ +T ++ Sbjct: 355 HAKNKKMESKVSLETIARRTPGFSGADLANLLNEAAILTARRRKSAMTMSE 405
>FTSH_MYCGE (P47695) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 702 Score = 30.4 bits (67), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H LS ++L + FSGA ++ + E+ LLA+R+ R + D Sbjct: 413 HAENKNLSSKISLLDVAKRTPGFSGAQLENVINEATLLAVRDNRTTININD 463
>MEI1_CAEEL (P34808) Meiotic spindle formation protein mei-1 (EC 3.6.4.3)| (Katanin ATPase-containing subunit) Length = 472 Score = 30.4 bits (67), Expect = 2.1 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -2 Query: 424 SDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 SD++N ++ + FSGAD+ ++C + + LR Sbjct: 381 SDEINYDDLAARTEGFSGADVVSLCRTAAINVLR 414
>SPG7_HUMAN (Q9UQ90) Paraplegin (EC 3.4.24.-) (Spastic paraplegia protein 7)| Length = 795 Score = 30.0 bits (66), Expect = 2.7 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = -2 Query: 436 KMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 K+T S + FSGADI IC E+ L A RE V +F Sbjct: 497 KLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNF 545
>SEC18_YEAST (P18759) Vesicular-fusion protein SEC18| Length = 758 Score = 30.0 bits (66), Expect = 2.7 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 16/62 (25%) Frame = -2 Query: 427 LSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE----------------RRMKVTHA 296 +SDDVNL E FSGA+I+ + + A+ + ++KVT Sbjct: 441 MSDDVNLAELAALTKNFSGAEIEGLVKSASSFAINKTVNIGKGATKLNTKDIAKLKVTRE 500 Query: 295 DF 290 DF Sbjct: 501 DF 502
>FTSH_GUITH (O78516) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 631 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H L ++LE FSGAD+ + E+ +L R R+ ++T Sbjct: 355 HARNKKLDLSISLELIAKRTPGFSGADLANLLNEAAILTARRRKKQIT 402
>KAIC_SYNLI (Q8GGL1) Circadian clock protein kinase kaiC (EC 2.7.11.1)| Length = 541 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 25 LMIQYFERKASTDRSTTNYSI-IQPFRRRKGYKQICAYPPNQGI 153 ++ Y E +A R+ +++ I ++ F R+ K ICAYP + G+ Sbjct: 334 ILFAYEESRAQLSRNASSWGIDLEEFERQGLLKIICAYPESAGL 377
>FTSH_STRR6 (P59652) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 652 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H L++DV+L+ F GAD++ + E+ L+A R + + +D Sbjct: 369 HAKNKPLAEDVDLKLVAQQTPGFVGADLENVLNEAALVAARRNKSIIDASD 419
>FTSH_STRPN (O69076) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 652 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H L++DV+L+ F GAD++ + E+ L+A R + + +D Sbjct: 369 HAKNKPLAEDVDLKLVAQQTPGFVGADLENVLNEAALVAARRNKSIIDASD 419
>NVL_HUMAN (O15381) Nuclear valosin-containing protein-like (Nuclear VCP-like| protein) (NVLp) Length = 856 Score = 29.6 bits (65), Expect = 3.5 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 13/62 (20%) Frame = -2 Query: 436 KMTLSDDVNLEEFV--MTKDEFSGADIKAICTESGLLALRER-----------RMKVTHA 296 K L DVNLE + D ++GAD+ A+ E+ + ALR+ +KV+H Sbjct: 767 KPPLDADVNLEAIAGDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHK 826 Query: 295 DF 290 F Sbjct: 827 HF 828
>FTSH_BUCBP (Q89AF2) Cell division protein ftsH (EC 3.4.24.-)| Length = 610 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H K+ L ++V+ FSGAD+ + E+ L A R R V +DF Sbjct: 334 HMKKVPLGNNVDPMIIARGTPGFSGADLANLVNEAALFAARNNRDVVMMSDF 385
>PR6AA_XENLA (O42587) 26S protease regulatory subunit 6A-A (TAT-binding protein| 6) (TBP-6) Length = 405 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 H+ KM +S DVN EE K E+G++ALR Sbjct: 353 HSRKMNVSPDVNYEELARCPTISMALSAKQFGVEAGMIALR 393
>NVL_MOUSE (Q9DBY8) Nuclear valosin-containing protein-like (Nuclear VCP-like| protein) (NVLp) Length = 855 Score = 29.6 bits (65), Expect = 3.5 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 13/62 (20%) Frame = -2 Query: 436 KMTLSDDVNLEEFV--MTKDEFSGADIKAICTESGLLALRER-----------RMKVTHA 296 K L +DVNLE + + ++GAD+ A+ E+ L ALR+ +KV+H Sbjct: 766 KPPLDEDVNLETIANDLRCNCYTGADLTALVREASLCALRQEITAQKNGVGAGELKVSHK 825 Query: 295 DF 290 F Sbjct: 826 HF 827
>AFG2_YEAST (P32794) Protein AFG2| Length = 780 Score = 29.3 bits (64), Expect = 4.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 430 TLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRE 320 T V+L E + +SGA++ +C E+GL A+ E Sbjct: 702 TEESGVDLHELADRTEGYSGAEVVLLCQEAGLAAIME 738
>PEX1_PICPA (P46463) Peroxisome biosynthesis protein PAS1 (Peroxin-1)| Length = 1157 Score = 29.3 bits (64), Expect = 4.6 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMK 308 T M +S VNL FSGAD++A+ + L A+ E+ K Sbjct: 980 TRNMNVSKSVNLSSVAGECSGFSGADLQALAYNAYLKAVHEKLTK 1024
>FTSH2_SYNY3 (P73179) Cell division protein ftsH homolog 2 (EC 3.4.24.-)| Length = 665 Score = 29.3 bits (64), Expect = 4.6 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHAD 293 H L ++V L F+GAD+ + E+ + R R+ +T A+ Sbjct: 393 HAQNKKLHEEVQLAAIARRTPGFTGADLANVLNEAAIFTARRRKEAITMAE 443
>TBP7_CAEEL (P54816) TAT-binding homolog 7| Length = 1242 Score = 29.3 bits (64), Expect = 4.6 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -2 Query: 445 HTAKMTLSDDV--NLEEFVMTKDEFSGADIKAICTESGLLALRER 317 HT+K + + L+ + GAD+K +CTE+ L+ LR R Sbjct: 576 HTSKWEENKPIPETLDAIAERTSGYCGADLKFLCTEAVLIGLRSR 620
>RCA1_YEAST (P40341) Mitochondrial respiratory chain complexes assembly protein| RCA1 (EC 3.4.24.-) (TAT-binding homolog 12) Length = 825 Score = 28.9 bits (63), Expect = 6.0 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 379 FSGADIKAICTESGLLALR--ERRMKVTH 299 FSGADI +C E+ L+A R E +K+ H Sbjct: 555 FSGADIANVCNEAALIAARSDEDAVKLNH 583
>POLG_EMCV (P03304) Genome polyprotein [Contains: Coat protein VP4 (Rho); Coat| protein VP2 (Beta); Coat protein VP3 (Gamma); Coat protein VP1 (Alpha); Picornain 2A (EC 3.4.22.29) (Core protein P2A) (G); Core protein P2B (I); Core protein P2C (C); Core pro Length = 2290 Score = 28.9 bits (63), Expect = 6.0 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 86 LSNHSGEEKVTNKFAPILQTREYIPRYQ-IYYHYTMLFW 199 L+ HSG+++ FAP + +P ++ + Y + LFW Sbjct: 2252 LAVHSGKQEYDRLFAPFREVGVVVPSFESVEYRWRSLFW 2290
>PEX6_CANGA (Q6FW67) Peroxisomal biogenesis factor 6 (Peroxin-6)| Length = 1017 Score = 28.9 bits (63), Expect = 6.0 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -2 Query: 442 TAKMTLSDDVNLEEFVMTKD-EFSGADIKAICTESGLLAL 326 T K +S D+N +E V ++GAD A+C+++ L A+ Sbjct: 902 TRKFKVSSDINFDELVSDFPFSYTGADFYALCSDAMLKAM 941
>MASS1_MOUSE (Q8VHN7) Monogenic audiogenic seizure susceptibility protein 1| precursor (Very large G-protein coupled receptor 1) (Neurepin) Length = 6298 Score = 28.9 bits (63), Expect = 6.0 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 117 QTNLRLSSKPGNISHDTKYIITTQCCSGSEDRCTIH 224 QT L K N++ + +++ C+G + RC IH Sbjct: 5407 QTVTILQEKGANLTDELRFVAGVTTCTGGQTRCFIH 5442
>FTSH_MYCLE (Q9CD58) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 787 Score = 28.9 bits (63), Expect = 6.0 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H+ ++DD +L+ +GAD+ + E+ LL RE + +T Sbjct: 345 HSKGKPIADDADLDGLAKRTVGMTGADLANVVNEAALLTARENGLVIT 392
>AFG31_MOUSE (Q920A7) AFG3-like protein 1 (EC 3.4.24.-)| Length = 663 Score = 28.9 bits (63), Expect = 6.0 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -2 Query: 430 TLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 +LS D + F+GADI +C E+ L+A R V F Sbjct: 365 SLSKDALSRKLAALTPGFTGADISNVCNEAALIAARHLSPSVQERHF 411
>FTSH2_ARATH (Q9FH02) Cell division protein ftsH homolog 2, chloroplast| precursor (EC 3.4.24.-) Length = 704 Score = 28.5 bits (62), Expect = 7.9 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H+ + DV+ E+ F+GAD++ + E+ +LA R +++ Sbjct: 432 HSRGKAIGKDVDYEKVARRTPGFTGADLQNLMNEAAILAARRELKEIS 479
>FTSH1_ARATH (Q39102) Cell division protein ftsH homolog 1, chloroplast| precursor (EC 3.4.24.-) Length = 716 Score = 28.5 bits (62), Expect = 7.9 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVT 302 H+ L DV+ ++ F+GAD++ + E+ +LA R +++ Sbjct: 444 HSRGKALGKDVDFDKVARRTPGFTGADLQNLMNEAAILAARRELKEIS 491
>FTSH_CAPAN (Q39444) Cell division protein ftsH homolog, chloroplast precursor| (EC 3.4.24.-) (Fragment) Length = 662 Score = 28.5 bits (62), Expect = 7.9 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR 323 H+ L+ DV+ ++ F+GAD++ + E+ +LA R Sbjct: 412 HSRGKALAKDVDFDKIARRTPGFTGADLQNLMNEAAILAAR 452
>FTSH_BUCAI (P57462) Cell division protein ftsH (EC 3.4.24.-)| Length = 611 Score = 28.5 bits (62), Expect = 7.9 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H K+ LS DV+ FSGAD+ + E+ L A R + V+ +F Sbjct: 334 HMRKVPLSKDVDPMIIARGTPGFSGADLANLVNEAALFAARLDKRVVSMLEF 385
>FTSH_BUCAP (Q8K9G8) Cell division protein ftsH (EC 3.4.24.-)| Length = 613 Score = 28.5 bits (62), Expect = 7.9 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H K+ LS+DV+ FSGAD+ + E+ L A R V+ F Sbjct: 334 HMRKVPLSEDVDPMIIARGTPGFSGADLANLVNEAALFAARFNNRVVSMIHF 385
>FTSH_SHIFL (P0AAI4) Cell division protein ftsH (EC 3.4.24.-)| Length = 644 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H ++ L+ D++ FSGAD+ + E+ L A R + V+ +F Sbjct: 334 HMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEF 385
>FTSH_SALTY (P63343) Cell division protease ftsH (EC 3.4.24.-)| Length = 644 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H ++ L+ D++ FSGAD+ + E+ L A R + V+ +F Sbjct: 334 HMRRVPLATDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEF 385
>FTSH_SALTI (P63344) Cell division protease ftsH (EC 3.4.24.-)| Length = 644 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H ++ L+ D++ FSGAD+ + E+ L A R + V+ +F Sbjct: 334 HMRRVPLATDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEF 385
>FTSH_ECOLI (P0AAI3) Cell division protein ftsH (EC 3.4.24.-)| Length = 644 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H ++ L+ D++ FSGAD+ + E+ L A R + V+ +F Sbjct: 334 HMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEF 385
>FTSH_ECO57 (Q8X9L0) Cell division protease ftsH (EC 3.4.24.-)| Length = 644 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -2 Query: 445 HTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 H ++ L+ D++ FSGAD+ + E+ L A R + V+ +F Sbjct: 334 HMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEF 385
>AFG32_HUMAN (Q9Y4W6) AFG3-like protein 2 (EC 3.4.24.-) (Paraplegin-like| protein) Length = 797 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -2 Query: 430 TLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERRMKVTHADF 290 TL D + FSGAD+ +C E+ L+A R + F Sbjct: 499 TLEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHF 545 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,812,866 Number of Sequences: 219361 Number of extensions: 1166086 Number of successful extensions: 3111 Number of sequences better than 10.0: 165 Number of HSP's better than 10.0 without gapping: 3008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3110 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)