| Clone Name | rbart37a11 |
|---|---|
| Clone Library Name | barley_pub |
>USH2A_RAT (Q8K3K1) Usherin precursor (Usher syndrome type-2A protein homolog)| (Usher syndrome type IIa protein homolog) Length = 1512 Score = 32.7 bits (73), Expect = 0.22 Identities = 20/62 (32%), Positives = 23/62 (37%), Gaps = 8/62 (12%) Frame = -3 Query: 315 HGHRAGCSPRRR------SQHRFTGNIKAPRTVARSRGAEFCRSHRAH--QCVPCLCFGH 160 HGH C RR S H FT + R F ++ H C PC C GH Sbjct: 517 HGHAETCDRTRRPYRCLCSPHSFTEGPQCGRCSPLYNDKPFRSGNKVHAFNCKPCQCHGH 576 Query: 159 VS 154 S Sbjct: 577 AS 578
>GSH1_BORPA (Q7W3F2) Glutamate--cysteine ligase (EC 6.3.2.2)| (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS) Length = 527 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 119 DTFAGNVYG*VTETWPKHRQ-GTH**ARWLRQNS 217 DTF G +Y VTE WP ++ GT +W++ N+ Sbjct: 253 DTFLGRLYEAVTEPWPAYQAIGTRRDGQWIQLNT 286
>GSH1_BORBR (Q7WES2) Glutamate--cysteine ligase (EC 6.3.2.2)| (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS) Length = 527 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 119 DTFAGNVYG*VTETWPKHRQ-GTH**ARWLRQNS 217 DTF G +Y VTE WP ++ GT +W++ N+ Sbjct: 253 DTFLGRLYEAVTEPWPAYQAIGTRRDGQWIQLNT 286
>LAMC3_MOUSE (Q9R0B6) Laminin gamma-3 chain precursor (Laminin 12 gamma 3| subunit) Length = 1581 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 8/60 (13%) Frame = -3 Query: 315 HGHRAGCSPRR------RSQHRFTGNIKAPRTVARSRGAEFCR--SHRAHQCVPCLCFGH 160 +GH + C P R QH TG + R + + + R + A++C+PC C GH Sbjct: 283 NGHASECEPNAAGQLACRCQHNTTG-VDCERCLPFFQDRPWARGTAEDANECLPCNCSGH 341
>NAPG_SHIFL (P0AAL5) Ferredoxin-type protein napG| Length = 231 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 117 AIHLLVMSMARLQKHGRSIGKEHTDEHGGCGRTRRPCCVQQ 239 AI L + R KH R + H+D GCG+ + C ++Q Sbjct: 160 AITLELERNTRTGKHARFLPTVHSDACTGCGKCEKVCVLEQ 200
>NAPG_ECOLI (P0AAL3) Ferredoxin-type protein napG| Length = 231 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 117 AIHLLVMSMARLQKHGRSIGKEHTDEHGGCGRTRRPCCVQQ 239 AI L + R KH R + H+D GCG+ + C ++Q Sbjct: 160 AITLELERNTRTGKHARFLPTVHSDACTGCGKCEKVCVLEQ 200
>NAPG_ECOL6 (P0AAL4) Ferredoxin-type protein napG| Length = 231 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 117 AIHLLVMSMARLQKHGRSIGKEHTDEHGGCGRTRRPCCVQQ 239 AI L + R KH R + H+D GCG+ + C ++Q Sbjct: 160 AITLELERNTRTGKHARFLPTVHSDACTGCGKCEKVCVLEQ 200
>USH2A_MOUSE (Q2QI47) Usherin precursor (Usher syndrome type-2A protein homolog)| (Usher syndrome type IIa protein homolog) Length = 5193 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 8/62 (12%) Frame = -3 Query: 315 HGHRAGCSPRRR------SQHRFTGNIKAPRTVARSRGAEFCRSHR--AHQCVPCLCFGH 160 HGH C RR S H FT + R F A C PC C GH Sbjct: 518 HGHAETCDRTRRPYRCLCSPHSFTEGPQCDRCSPLYNDKPFRSGDNVNAFNCKPCQCHGH 577 Query: 159 VS 154 S Sbjct: 578 AS 579
>SLIT1_RAT (O88279) Slit homolog 1 protein precursor (Slit-1) (Multiple| epidermal growth factor-like domains 4) Length = 1531 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 143 HRHYQQMYRCTIRCGVDSRGCAVFIPCCSDN 51 H ++YRCT G R C V + CS N Sbjct: 941 HNDPLEVYRCTCPSGYKGRNCEVSLDSCSSN 971
>TRPV1_RAT (O35433) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) (Vanilloid receptor type 1-like) (Capsaicin receptor) Length = 838 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 19 YLLCFNT*TVTLSLQHGMNTAQPRESTPHR 108 +L F+T VTL ++ G N + P ESTPH+ Sbjct: 587 FLFGFSTAVVTL-IEDGKNNSLPMESTPHK 615
>O10Q1_HUMAN (Q8NGQ4) Olfactory receptor 10Q1| Length = 319 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 187 VCSLPMLRPCFCNLAIDITSKCIAVPYDAG*IHAAAPCSYHVAVIMLQFMC 35 V ++P L C + IT +++ G A + CS+H+ V++LQ+ C Sbjct: 211 VLTIPFL--LICVSYVFITCAILSIRSAEGRRRAFSTCSFHLTVVLLQYGC 259
>SLIT1_MOUSE (Q80TR4) Slit homolog 1 protein precursor (Slit-1)| Length = 1531 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 143 HRHYQQMYRCTIRCGVDSRGCAVFIPCCSDN 51 H ++YRCT G R C V + CS N Sbjct: 941 HNDPLEVYRCTCPSGYKGRHCEVSLDGCSSN 971
>LAMC3_HUMAN (Q9Y6N6) Laminin gamma-3 chain precursor (Laminin 12 gamma 3| subunit) Length = 1587 Score = 27.7 bits (60), Expect = 7.2 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 8/59 (13%) Frame = -3 Query: 315 HGHRAGCSP------RRRSQHRFTGNIKAPRTVARSRGAEFCR--SHRAHQCVPCLCFG 163 +GH + C P R QH TG R + + + R + AH+C+PC C G Sbjct: 274 NGHASECGPDVAGQLACRCQHNTTGT-DCERCLPFFQDRPWARGTAEAAHECLPCNCSG 331
>LAMC1_HUMAN (P11047) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1609 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 186 CVPCLCFGHVSV 151 C PC CFGH SV Sbjct: 492 CTPCFCFGHSSV 503
>PHNS_DESGI (P12943) Periplasmic [NiFe] hydrogenase small subunit precursor (EC| 1.12.2.1) (NiFe hydrogenlyase small chain) Length = 288 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 Query: 111 GTAIHLLVMSMARLQKHGRSIGKEHTDEHGGCGRTR 218 GT +HLL M L K GR + H C R + Sbjct: 181 GTVVHLLTKGMPELDKQGRPVMFFGETVHDNCPRLK 216
>LNT_PSEPK (Q88DN4) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 505 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 194 ARWLRQNSAPLLRATVLGALIFPVNRCWLLR 286 ARWLR+N APL A AL WLL+ Sbjct: 111 ARWLRRNEAPLADALCFAAL-------WLLQ 134
>ENV_MMTVG (P03374) Env polyprotein [Contains: Coat protein GP52; Coat protein| GP36] Length = 688 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 214 LGAPAACNSSGSFDIPCESVLAPAPWGATCPVAVVT 321 LG P S +P +L P WG+T P+ V+T Sbjct: 91 LGPPPVTGESYWAYLPKPPILHPVGWGSTDPIRVLT 126
>ENV_MMTVB (P10259) Env polyprotein [Contains: Coat protein GP52; Coat protein| GP36] Length = 688 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 214 LGAPAACNSSGSFDIPCESVLAPAPWGATCPVAVVT 321 LG P S +P +L P WG+T P+ V+T Sbjct: 91 LGPPPVTGESYWAYLPKPPILHPVGWGSTDPIRVLT 126
>LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1607 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 186 CVPCLCFGHVSV 151 C PC CFGH SV Sbjct: 490 CTPCFCFGHSSV 501
>IBP4_BOVIN (Q05716) Insulin-like growth factor-binding protein 4 precursor| (IGFBP-4) (IBP-4) (IGF-binding protein 4) Length = 258 Score = 27.7 bits (60), Expect = 7.2 Identities = 20/71 (28%), Positives = 26/71 (36%) Frame = +3 Query: 99 PASYGTAIHLLVMSMARLQKHGRSIGKEHTDEHGGCGRTRRPCCVQQFWEL*YSL*IGAG 278 P+ AIH S +L + +G E GCG CC Sbjct: 18 PSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCG-----CCA--------------- 57 Query: 279 SCALGSNLPCG 311 +CALG +PCG Sbjct: 58 TCALGKGMPCG 68
>FTSKL_ANASP (Q8ZS46) Hypothetical ftsK-like protein all7666| Length = 725 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 125 MYRCTIRCGVDSRGCAVFIPCCSDNVTVHVLKQSKYSG 12 +Y +I GVD G V IP SDNVT H+L + G Sbjct: 350 IYSVSIPGGVDVDGTYVEIPLYSDNVT-HILGGGRTRG 386
>LAML1_CAEEL (Q18823) Laminin-like protein C54D1.5 precursor| Length = 1535 Score = 27.3 bits (59), Expect = 9.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 186 CVPCLCFGHVSV 151 C PC CFGH S+ Sbjct: 485 CTPCFCFGHSSI 496
>IBP4_SHEEP (Q28893) Insulin-like growth factor-binding protein 4 (IGFBP-4)| (IBP-4) (IGF-binding protein 4) Length = 237 Score = 27.3 bits (59), Expect = 9.4 Identities = 19/65 (29%), Positives = 24/65 (36%) Frame = +3 Query: 117 AIHLLVMSMARLQKHGRSIGKEHTDEHGGCGRTRRPCCVQQFWEL*YSL*IGAGSCALGS 296 AIH S +L + +G E GCG CC +CALG Sbjct: 3 AIHCPPCSEEKLARCRPPVGCEELVREPGCG-----CCA---------------TCALGK 42 Query: 297 NLPCG 311 +PCG Sbjct: 43 GMPCG 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,013,641 Number of Sequences: 219361 Number of extensions: 1026024 Number of successful extensions: 2817 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2817 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)