Clone Name | rbart37a10 |
---|---|
Clone Library Name | barley_pub |
>ARFP_ARATH (Q93YR9) Auxin response factor 16| Length = 670 Score = 55.8 bits (133), Expect = 6e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 479 YRDAAGALKHTGDEPFSDFTKTARRLTILTDTSGDSSV 366 YRDA+GA+K+ G+EPFS+F KTARRLTILT+ +S V Sbjct: 632 YRDASGAIKYAGNEPFSEFLKTARRLTILTEQGSESVV 669
>ARFJ_ARATH (Q9SKN5) Auxin response factor 10| Length = 693 Score = 49.7 bits (117), Expect = 4e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -1 Query: 479 YRDAAGALKHTGDEPFSDFTKTARRLTILTDTSGDS 372 YRDA G +K GDEPFSDF K +RLTI D GD+ Sbjct: 629 YRDANGVIKRIGDEPFSDFMKATKRLTIKMDIGGDN 664
>DYIN_DICDI (P54703) Dynein intermediate chain, cytosolic (DH IC) (Cytoplasmic| dynein intermediate chain) Length = 652 Score = 31.6 bits (70), Expect = 1.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 153 GTSLIIGEKLKLPAPVVLLDLHPGRGGSPF 242 G +++ E+ K P+ +DLHP +GG+ F Sbjct: 478 GNRIVMNERYKELGPITSVDLHPSKGGADF 507
>GLXD_RHIME (O87392) Glutamate synthase large subunit-like protein| Length = 442 Score = 31.2 bits (69), Expect = 1.5 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 8/73 (10%) Frame = -2 Query: 322 VRATAGRGAAPHGGG-------SQRA*IEWRQTPNGEPPRPGCKSRSTTGAGSFSFSPI- 167 + G+GA P GGG S R R P G R C+ TG + Sbjct: 159 IEVVVGQGAKPGGGGMLLGQKISDRV-ANMRNLPKGIDQRSACRHPDWTGPDDLEIKILE 217 Query: 166 IREVPEWDG*LFV 128 +RE+ +W+ ++V Sbjct: 218 LREITDWEKPIYV 230
>IAA16_ORYSA (P0C127) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 228 Score = 30.8 bits (68), Expect = 1.9 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = -1 Query: 479 YRDAAGALKHTGDEPFSDFTKTARRLTILTDTSGDSSVAS*GVRKEASS 333 Y D G GD P++ F ARRL +L + ++S G RK A++ Sbjct: 179 YEDDEGDQMLVGDVPWNMFIAAARRLRVLRSSDLNASTIRAGSRKRAAA 227
>STK31_HUMAN (Q9BXU1) Serine/threonine-protein kinase 31 (EC 2.7.11.1)| (Serine/threonine-protein kinase NYD-SPK) Length = 1019 Score = 30.8 bits (68), Expect = 1.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 71 IIIMGTSQHNERKKSVQGSHKQSSVPFWDLSNNRRK 178 I+ M H ++ + V GSH + +V FW S NR K Sbjct: 21 IVQMDEDTHYDKVEDVVGSHIEDAVTFWAQSINRNK 56
>UBP10_YEAST (P53874) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) Length = 792 Score = 30.0 bits (66), Expect = 3.3 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 44 IPSLRYYYYIIIMGTSQHNERKKSVQGSHKQSSVPFW-DLSNNRRKTEAA 190 IPS+++Y + I+MG K SV + ++S W +S N RK +A Sbjct: 383 IPSIQHYLFDILMGKYDSTISKNSVSYTLAETSKKMWLPVSKNPRKNVSA 432
>Y489_MYCPN (P75296) Hypothetical lipoprotein MG338 homolog precursor| (P02_orf1300) Length = 1300 Score = 29.6 bits (65), Expect = 4.3 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +2 Query: 2 IHSSQEFQQGEPPWIPSLRYYYYIIIMGTSQHNERKKSVQGSHKQSSVPFWDLSNNRRKT 181 + S FQ + + Y + +MG+ Q + K SVQGS + +SV NR+++ Sbjct: 575 LESGSLFQTWAQTGLTAKLYGALVAMMGSGQGTQVKGSVQGSSRAASVSVQTTQQNRQQS 634
>IAA12_ORYSA (Q75GK1) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) Length = 226 Score = 29.3 bits (64), Expect = 5.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -1 Query: 479 YRDAAGALKHTGDEPFSDFTKTARRLTIL 393 Y+D G L GD PF FT T ++L I+ Sbjct: 182 YQDKDGDLMLVGDVPFDMFTSTCKKLRIM 210
>TEN3_TENMO (Q27270) Tenecin-3 precursor| Length = 96 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 423 HEDGA*ADDTNGHERRQQRSELGGEEGSKLFRH 325 H DG GH+ QQ LGG++G L H Sbjct: 20 HHDGHLGGHQTGHQGGQQGGHLGGQQGGHLGGH 52
>IAA34_ARATH (Q9C5X0) Auxin-responsive protein IAA34 (Indoleacetic acid-induced| protein 34) Length = 185 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 479 YRDAAGALKHTGDEPFSDFTKTARRLTI 396 YRD G ++ GD P+++F ++ RL I Sbjct: 148 YRDEEGLWRNAGDVPWNEFIESVERLRI 175
>FREM3_HUMAN (P0C091) FRAS1-related extracellular matrix protein 3 precursor| Length = 2135 Score = 28.5 bits (62), Expect = 9.6 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -3 Query: 354 GEEGSKLFRHLYVLQLGGAQRRTVAVLRERR*SGGKPRMASPRGLDASQEAPPVQAASV 178 GE+ S +HL+V + Q + + + SG ++AS G SQ P+ A S+ Sbjct: 1082 GEKNSLTLQHLHVEDVDTHQDELLCTVTSQPASGYLEKIASAPGSKMSQSGSPISAFSL 1140 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,406,747 Number of Sequences: 219361 Number of extensions: 1593214 Number of successful extensions: 5288 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 5058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5279 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)