| Clone Name | rbart37a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MDFI_MOUSE (P70331) MyoD family inhibitor (Myogenic repressor I-mf) | 34 | 0.24 | 2 | MDFI_HUMAN (Q99750) MyoD family inhibitor (Myogenic repressor I-mf) | 32 | 1.2 | 3 | HMCN1_HUMAN (Q96RW7) Hemicentin-1 precursor (Fibulin-6) (FIBL-6) | 29 | 7.6 | 4 | C3G_DROME (O77086) Guanine nucleotide-releasing factor 2 (CRK SH... | 29 | 7.6 |
|---|
>MDFI_MOUSE (P70331) MyoD family inhibitor (Myogenic repressor I-mf)| Length = 251 Score = 33.9 bits (76), Expect = 0.24 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +1 Query: 316 PSGSAKMGNGILGGGRCSRMVSTWVSSASTAPRRAVASCRTAS 444 P + GNG LGG + R + T S S A R++ S R+AS Sbjct: 111 PGSAGHAGNGALGGSKAHRKLQTHPSLGSQAGRKSRGSARSAS 153
>MDFI_HUMAN (Q99750) MyoD family inhibitor (Myogenic repressor I-mf)| Length = 246 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +1 Query: 322 GSAKMGNGILGGGRCSRMVSTWVSSASTAPRRAVASCRTASTRHP 456 G+ + GNG LGG + R + T S AS +++ +S ++ +++ P Sbjct: 112 GTRRAGNGALGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIP 156
>HMCN1_HUMAN (Q96RW7) Hemicentin-1 precursor (Fibulin-6) (FIBL-6)| Length = 5635 Score = 28.9 bits (63), Expect = 7.6 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 251 HGRQHLWTCEFIPPTLPCFAS 189 HG+Q L T E IP TLPC AS Sbjct: 985 HGQQILSTIEGIPVTLPCKAS 1005
>C3G_DROME (O77086) Guanine nucleotide-releasing factor 2 (CRK SH3-binding| GNRP) Length = 1571 Score = 28.9 bits (63), Expect = 7.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 241 CRPCPSIHPFHXXXXXXXXXRLQITPSGSAKMGNGILGGG 360 C P P H H +LQ TP GS+++G GGG Sbjct: 211 CTPPPPTHQHHSQHQ-----QLQGTPGGSSRVGGAGAGGG 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,418,915 Number of Sequences: 219361 Number of extensions: 1188852 Number of successful extensions: 3674 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3671 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)