| Clone Name | rbart36h06 |
|---|---|
| Clone Library Name | barley_pub |
>RK3B_ARATH (Q9LRN8) 50S ribosomal protein L3-2, chloroplast precursor| Length = 324 Score = 78.2 bits (191), Expect = 1e-14 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = -3 Query: 499 KGQVPGPQGSFLFVKDSIYKKPDRALLPFPTYFSQEGES-EDMEPLIADLGDVDPFMAAD 323 +GQVPG +G+F+F+KD+ KKPD + LPFPTY + E E ++EPL+ADLG+VDPFM A+ Sbjct: 265 RGQVPGAEGNFVFIKDAWCKKPDISKLPFPTYLAPEDEDPSELEPLVADLGEVDPFMLAE 324
>RM03_BOVIN (Q3ZBX6) Mitochondrial 39S ribosomal protein L3 (L3mt) (MRP-L3)| Length = 348 Score = 33.9 bits (76), Expect = 0.25 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 496 GQVPGPQGSFLFVKDSIYK--KPDRALLPFPTYFSQEGESEDMEPL 365 G VPG + + +KDS+ K LPFPTYF E E E E L Sbjct: 287 GSVPGHRNCLVKIKDSVLPAYKDFCKNLPFPTYFPDEDEKELPEDL 332
>RL3_THETN (Q8R7V4) 50S ribosomal protein L3| Length = 210 Score = 32.0 bits (71), Expect = 0.95 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 499 KGQVPGPQGSFLFVKDSIYKK 437 KG VPGP+GS L ++DS+ K Sbjct: 190 KGSVPGPKGSLLIIRDSVKSK 210
>RL3_CAUCR (Q9A8V3) 50S ribosomal protein L3| Length = 255 Score = 30.8 bits (68), Expect = 2.1 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = -3 Query: 499 KGQVPGPQGSFLFVKDSIYKKPDRALLPFPTYFSQEGES 383 KG VPG +GS++ V+D++ KK A P P F + GE+ Sbjct: 196 KGAVPGHEGSYVKVRDAV-KKALPADAPRPGAFRKAGEA 233
>RM03_MOUSE (Q99N95) Mitochondrial 39S ribosomal protein L3 (L3mt) (MRP-L3)| Length = 348 Score = 30.8 bits (68), Expect = 2.1 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -3 Query: 496 GQVPGPQGSFLFVKDSIYK--KPDRALLPFPTYFSQEGESEDMEPL 365 G VPG + + +KDS K LPFPTYF E E E L Sbjct: 287 GSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDL 332
>RM03_HUMAN (P09001) Mitochondrial 39S ribosomal protein L3 (L3mt) (MRP-L3)| Length = 348 Score = 30.8 bits (68), Expect = 2.1 Identities = 21/47 (44%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -3 Query: 496 GQVPGPQGSFLFVKDS---IYKKPDRALLPFPTYFSQEGESEDMEPL 365 G VPG + + VKDS YK + L PFPTYF E E E L Sbjct: 287 GSVPGHKNCLVKVKDSKLPAYKDLGKNL-PFPTYFPDGDEEELPEDL 332
>ADPN_HUMAN (Q9NST1) Adiponutrin (iPLA2-epsilon) (Calcium-independent| phospholipase A2-epsilon) (Patatin-like phospholipase domain-containing protein 3) [Includes: Triacylglycerol lipase (EC 3.1.1.3); Acylglycerol O-acyltransferase (EC 2.3.1.-)] Length = 481 Score = 29.3 bits (64), Expect = 6.2 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 Query: 235 GYMSGSRVTRVIPLLTSQIIVVPCTLPGRYARALTQ 128 GYMS ++ ++P+ +++PCTLP A A+ Q Sbjct: 337 GYMS--KICNLLPIRIMSYVMLPCTLPVESAIAIVQ 370 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,383,936 Number of Sequences: 219361 Number of extensions: 1521665 Number of successful extensions: 3546 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3543 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)