Clone Name | rbart36h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BCL6B_MOUSE (O88282) B-cell CLL/lymphoma 6 member B protein (Bcl... | 29 | 2.8 | 2 | STRB1_STRGR (P08078) Inosamine-phosphate amidinotransferase 1 (E... | 29 | 3.7 |
---|
>BCL6B_MOUSE (O88282) B-cell CLL/lymphoma 6 member B protein (Bcl6-associated| zinc finger protein) Length = 474 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 236 PPATRAMPPPCKKLFSCRDC*SV*AC 159 P + +A PPP + FSC++C +V C Sbjct: 282 PASKQANPPPGSEFFSCQNCEAVAGC 307
>STRB1_STRGR (P08078) Inosamine-phosphate amidinotransferase 1 (EC 2.1.4.2)| (Inosamine-phosphate amidinotransferase I) (Aminocyclitol amidinotransferase) (ADT) Length = 346 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 129 YHDMIIAHTHTRSHALAITATKQFLTWRRHGPR 227 Y D ++ T H LA TK +T RR GPR Sbjct: 52 YPDRVLKETEEELHVLAAELTKLGVTVRRPGPR 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,293,088 Number of Sequences: 219361 Number of extensions: 598470 Number of successful extensions: 1108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1107 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)