Clone Name | rbart36g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OR6C2_HUMAN (Q9NZP2) Olfactory receptor 6C2 (HSA3) | 32 | 0.81 | 2 | WRT1_CAEEL (Q94128) Warthog protein 1 precursor [Contains: Warth... | 31 | 2.4 | 3 | AMC1_ORYSA (P27940) Alpha-amylase isozyme C (EC 3.2.1.1) (1,4-al... | 30 | 3.1 | 4 | YG41_SCHPO (O60176) Hypothetical RNA-binding protein C23E6.01c i... | 29 | 9.0 |
---|
>OR6C2_HUMAN (Q9NZP2) Olfactory receptor 6C2 (HSA3)| Length = 312 Score = 32.3 bits (72), Expect = 0.81 Identities = 13/41 (31%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = +3 Query: 369 ILRIGCT---IVSIRTLLISIVAVAITLVCILLGRLFVLAT 482 +L+I C+ ++ +L+++ A+ ITLVC++L L+++ T Sbjct: 182 LLKISCSDTWVIEQMVILMAVFALIITLVCVILSYLYIVRT 222
>WRT1_CAEEL (Q94128) Warthog protein 1 precursor [Contains: Warthog protein 1| N-product; Warthog protein 1 C-product] Length = 485 Score = 30.8 bits (68), Expect = 2.4 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +2 Query: 329 NCHNQSIHSFAC*DLAHWVHHSKHQDPVDIHSSCCHYPGLHPAGE 463 NC + S +C + WV K D D+ CCHY GL A E Sbjct: 98 NCPRE-FSSSSCSNPMTWVGGFKASDNGDLSLQCCHYEGLRFAQE 141
>AMC1_ORYSA (P27940) Alpha-amylase isozyme C (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) (Isozyme 1B) Length = 348 Score = 30.4 bits (67), Expect = 3.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 448 ASCWGGCLFWLRP 486 A+CWGGC W RP Sbjct: 85 ATCWGGCTIWTRP 97
>YG41_SCHPO (O60176) Hypothetical RNA-binding protein C23E6.01c in chromosome| II Length = 473 Score = 28.9 bits (63), Expect = 9.0 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 Query: 515 IGSSNVRLSWGRSQN 471 +G+S +RLSWGR+QN Sbjct: 363 LGNSRIRLSWGRNQN 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,128,448 Number of Sequences: 219361 Number of extensions: 1000369 Number of successful extensions: 2346 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2346 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)