Clone Name | rbart36f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GPT1_CANAL (O74248) Putative polyamine transporter | 28 | 8.0 |
---|
>GPT1_CANAL (O74248) Putative polyamine transporter| Length = 553 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = -2 Query: 133 WFTC----SLSAYALPSVSGVCMCLCLGNCSIVSP 41 WFTC S A PSVS C C+ L S P Sbjct: 122 WFTCWTNWSCQITAAPSVSYSCACMMLALHSFTDP 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,637,348 Number of Sequences: 219361 Number of extensions: 446860 Number of successful extensions: 1268 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1268 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)