Clone Name | rbart36e10 |
---|---|
Clone Library Name | barley_pub |
>WDR8_HUMAN (Q9P2S5) WD-repeat protein 8| Length = 460 Score = 52.4 bits (124), Expect = 6e-07 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -1 Query: 479 DPTCPRLVLCTESPHLYMWTPSGACCVNIP-LPNFRIVDLKWNSAGSCLLLKDRDSFC 309 DP PRL +CT LY+W+P+G V +P +F ++ L W+ +G + L +D FC Sbjct: 382 DPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSMALLSKDHFC 439
>WDR8_MOUSE (Q9JM98) WD-repeat protein 8| Length = 462 Score = 52.0 bits (123), Expect = 8e-07 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 3/60 (5%) Frame = -1 Query: 479 DPTCPRLVLCTESPHLYMWTPSGACCVNIPLP---NFRIVDLKWNSAGSCLLLKDRDSFC 309 DP PRL +CT +Y+W+P+G CV++ +P +F ++ L W+ +G L L +D FC Sbjct: 382 DPQQPRLAICTGGSKVYLWSPAG--CVSVQVPGEGDFAVLGLCWHLSGDSLALLSKDHFC 439
>RIR1_ENCCU (Q8SR37) Ribonucleoside-diphosphate reductase large chain (EC| 1.17.4.1) (Ribonucleotide reductase) Length = 768 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 146 SIWVRRLF*SGRVRNTEECCFFCYTTAVGFLEV 48 ++W+ LF RV+N EE FC + AVG +V Sbjct: 325 ALWINDLF-MERVKNNEEWSLFCPSQAVGLSDV 356
>CASK_BUBBU (P11840) Kappa-casein precursor| Length = 190 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 60 PNSSCITEETTFFRVPHPSRSEQS--PHPNRSTANLLCYNVIISID 191 P SC + TT R PHP S + P N+ + N I+S++ Sbjct: 105 PAKSCQAQPTTMTRHPHPHLSFMAIPPKKNQDKTEIPTINTIVSVE 150
>HEM31_STRAW (Q82E76) Porphobilinogen deaminase 1 (EC 2.5.1.61) (PBG 1)| (Hydroxymethylbilane synthase 1) (HMBS 1) (Pre-uroporphyrinogen synthase 1) Length = 324 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 396 HSLAELPDSRPEMELSGKLPPPQGPRFVLLCRD 298 HSL +LP ++P+ +P + PR VL+ RD Sbjct: 78 HSLKDLPTAQPDELALAAVPVREDPRDVLVARD 110
>POLR_EPMV (P20126) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1839 Score = 28.9 bits (63), Expect = 7.3 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 13/58 (22%) Frame = -3 Query: 471 VPTPRLVHG-------------EPAPVHVDAIRRLLRQHSLAELPDSRPEMELSGKLP 337 V +PRL+H P P+ V + L HSL P RP +EL +LP Sbjct: 444 VSSPRLLHSILPSQLRGAAIPNRPLPLWVTKLHHFLDSHSLLPTPPIRPRIELQ-RLP 500
>Y909_VIBPA (Q87R88) UPF0061 protein VP0909| Length = 489 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -3 Query: 396 HSLAELP----DSRPEMELSGKLPPPQGPRFVLLC 304 H LAE+ DS+PE E KLPP G + + C Sbjct: 453 HRLAEILRHPYDSQPEFEAYAKLPPEWGKKMEISC 487
>CAC2_YEAST (Q04199) Chromatin assembly factor 1 subunit p60 (CAF-1 60 kDa| subunit) Length = 468 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 374 IVDLKWNSAGSCLLLKDRDSFC 309 I DL W+ GS LL+ D FC Sbjct: 376 ITDLAWSEDGSTLLISSTDGFC 397
>INX6_DROME (Q9VR82) Innexin inx6 (Innexin-6) (Gap junction protein prp6)| (Pas-related protein 6) Length = 481 Score = 28.5 bits (62), Expect = 9.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 479 DPTCPRLVLCTESPHLYMWTPSGACCVNIPLPNFRIVDL 363 DPT R +CTES H P+ A +N+ PN I+ + Sbjct: 435 DPTADRHSICTESSHRVTAMPT-APTLNLMAPNDEIISM 472 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,382,165 Number of Sequences: 219361 Number of extensions: 1180314 Number of successful extensions: 3612 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3610 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)