| Clone Name | rbart36e02 |
|---|---|
| Clone Library Name | barley_pub |
>PATR_THEFY (Q47KH1) Putative phenylalanine aminotransferase (EC 2.6.1.-)| Length = 359 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 263 ERQANPGGLAAMPWVAMELYSTLPGLAGV--LSVPVLPSVYDL 141 E A PG W + E Y L GLAG + VP+ +DL Sbjct: 100 EATAEPGAEVVYAWRSFEAYPLLTGLAGATPIHVPLREETHDL 142
>ATRN_HUMAN (O75882) Attractin precursor (Mahogany homolog) (DPPT-L)| Length = 1429 Score = 29.6 bits (65), Expect = 3.4 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -2 Query: 211 NFTAPCQGWLAFSLYQYFL---QCMILFLSCWISGLRKNSVEFKVK 83 NFT P + +AFS + F+ Q + F SC++S L +V +K+K Sbjct: 1259 NFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIK 1304
>ATRN_RAT (Q99J86) Attractin precursor (Zitter protein)| Length = 1432 Score = 29.6 bits (65), Expect = 3.4 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -2 Query: 211 NFTAPCQGWLAFSLYQYFL---QCMILFLSCWISGLRKNSVEFKVK 83 NFT P + +AFS + F+ Q + F SC++S L +V +K+K Sbjct: 1262 NFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIK 1307
>ATRN_MOUSE (Q9WU60) Attractin precursor (Mahogany protein)| Length = 1428 Score = 29.6 bits (65), Expect = 3.4 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -2 Query: 211 NFTAPCQGWLAFSLYQYFL---QCMILFLSCWISGLRKNSVEFKVK 83 NFT P + +AFS + F+ Q + F SC++S L +V +K+K Sbjct: 1258 NFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIK 1303
>GYRB_CLOAB (P94604) DNA gyrase subunit B (EC 5.99.1.3)| Length = 637 Score = 29.3 bits (64), Expect = 4.4 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +3 Query: 3 HGTMTELKQD---FERPEVGAEAICRRPRGLT-LNSTLFFLRPDIQHDKNKIIH 152 HGT K D FE E + + +R R L LN + D +HDKN+I H Sbjct: 165 HGTKIYFKPDPEIFEDTEYDYDTLSQRLRELAFLNKGIKIELTDERHDKNEIFH 218
>AB14B_MOUSE (Q8VCR7) Abhydrolase domain-containing protein 14B| (CCG1-interacting factor B) Length = 210 Score = 29.3 bits (64), Expect = 4.4 Identities = 25/73 (34%), Positives = 31/73 (42%) Frame = -3 Query: 240 FSSHALGSDGTLQHLARVGWRXXXXXXXXXXXXXXCHAGYPA*GKTASNSKLSPVVGDRS 61 FSS + GTLQ LA G+R A P G+ A S L+ VV D Sbjct: 43 FSSETWQNLGTLQRLAEAGYRAVAIDLPGLGRSKEAAAPAPI-GEPAPGSFLAAVV-DTL 100 Query: 60 PLRPPLVFQSPVS 22 L PP+V +S Sbjct: 101 ELGPPVVISPSLS 113
>AATM_LUPAN (P26563) Aspartate aminotransferase-P2, mitochondrial precursor (EC| 2.6.1.1) (Transaminase A) (Fragment) Length = 454 Score = 28.9 bits (63), Expect = 5.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 76 GRRQIASAPTSGLSKSCFNSVMVPW 2 G + + SAPT G K+ FN VPW Sbjct: 172 GAKVLISAPTWGNHKNIFNDARVPW 196
>AAT5_ARATH (P46248) Aspartate aminotransferase, chloroplast precursor (EC| 2.6.1.1) (Transaminase A) Length = 453 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 76 GRRQIASAPTSGLSKSCFNSVMVPW 2 G + + S+PT G K+ FN VPW Sbjct: 171 GAKVVISSPTWGNHKNIFNDAKVPW 195 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,104,830 Number of Sequences: 219361 Number of extensions: 1614025 Number of successful extensions: 3850 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3846 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)