Clone Name | rbart36d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RS3_BURS3 (Q39KG1) 30S ribosomal protein S3 | 33 | 0.33 | 2 | RS3_BURPS (Q63Q17) 30S ribosomal protein S3 | 32 | 0.95 | 3 | RS3_BURP1 (Q3JMR9) 30S ribosomal protein S3 | 32 | 0.95 | 4 | RS3_BURMA (Q62GL1) 30S ribosomal protein S3 | 32 | 0.95 | 5 | ORYC_ORYSA (P25778) Oryzain gamma chain precursor (EC 3.4.22.-) | 30 | 2.8 | 6 | Y176_METTH (O26278) Hypothetical protein MTH176 | 29 | 6.2 | 7 | RNS1G_RAT (Q8VD89) Ribonuclease pancreatic gamma-type precursor ... | 28 | 8.1 |
---|
>RS3_BURS3 (Q39KG1) 30S ribosomal protein S3| Length = 266 Score = 33.1 bits (74), Expect = 0.33 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 288 DRRPHRAQQPPVRRPRLGLHGLDEAVRHGANGRGIGEP 401 D+RP R +P RRPR G R GA RG G+P Sbjct: 222 DKRPRRNARPGDRRPRRDGEGGAPGARRGAPRRGAGKP 259
>RS3_BURPS (Q63Q17) 30S ribosomal protein S3| Length = 266 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 288 DRRPHRAQQPPVRRPRLGLHGLDEAVRHGANGRGIGEP 401 D+RP R +P RRPR G R G RG G+P Sbjct: 222 DKRPRRNARPGDRRPRRDGEGGAPGARRGGPRRGAGKP 259
>RS3_BURP1 (Q3JMR9) 30S ribosomal protein S3| Length = 266 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 288 DRRPHRAQQPPVRRPRLGLHGLDEAVRHGANGRGIGEP 401 D+RP R +P RRPR G R G RG G+P Sbjct: 222 DKRPRRNARPGDRRPRRDGEGGAPGARRGGPRRGAGKP 259
>RS3_BURMA (Q62GL1) 30S ribosomal protein S3| Length = 266 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 288 DRRPHRAQQPPVRRPRLGLHGLDEAVRHGANGRGIGEP 401 D+RP R +P RRPR G R G RG G+P Sbjct: 222 DKRPRRNARPGDRRPRRDGEGGAPGARRGGPRRGAGKP 259
>ORYC_ORYSA (P25778) Oryzain gamma chain precursor (EC 3.4.22.-)| Length = 362 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 413 SSTQGFPDSSAIGAMTDSFIKAVESEPGTTYGRLLGAMR 297 +++ GF DS+ I ++TD A+ES GR GA+R Sbjct: 23 AASSGFDDSNPIRSVTDHAASALESTVIAALGRTRGALR 61
>Y176_METTH (O26278) Hypothetical protein MTH176| Length = 665 Score = 28.9 bits (63), Expect = 6.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 292 VALIAPSSRPYVVPGSDSTALMKLSVMAPMAEESGNPWVLDSADFWSSLQPL 447 +AL+APS RPY S+ ++ + + +SG PW + D + PL Sbjct: 405 LALVAPSRRPY-----SSSLPARIGGFSSLRPQSGGPWRVVVVDLPFGIIPL 451
>RNS1G_RAT (Q8VD89) Ribonuclease pancreatic gamma-type precursor (EC 3.1.27.5)| (RNase 1 gamma) Length = 152 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 10 CGSVWTFILIPLSTVQLKCPVPFAHKSQVQCRTGRQH 120 C S+ TF+ PL+TVQ C + QV C+ GR + Sbjct: 68 CKSMNTFVHEPLATVQAIC-----SQGQVTCKNGRNN 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,235,875 Number of Sequences: 219361 Number of extensions: 923180 Number of successful extensions: 3087 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3087 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)