Clone Name | rbart36c05 |
---|---|
Clone Library Name | barley_pub |
>CF075_RAT (Q7TNK6) Putative RNA methylase C6orf75 homolog (EC 2.1.1.-)| Length = 463 Score = 32.3 bits (72), Expect = 0.81 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 322 HIYVAILYPSSELNVDAPNLLEDAVVFIARFCWILQASSSPSTNSLPPWTPCSHALS 492 H+ V++ Y S++ +D N + +V R + L + T + PW PC +S Sbjct: 337 HVPVSLTYHLSDMFLDLINFAAETLVLGGRLVYWLPVYTPEYTEKMVPWHPCLRLVS 393
>CF075_PONPY (Q5R962) Putative RNA methylase C6orf75 homolog (EC 2.1.1.-)| Length = 463 Score = 32.3 bits (72), Expect = 0.81 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 322 HIYVAILYPSSELNVDAPNLLEDAVVFIARFCWILQASSSPSTNSLPPWTPCSHALS 492 H+ V++ Y S++ +D N + +V R + L + T + PW PC +S Sbjct: 340 HVPVSLSYHLSDMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELIS 396
>CF075_HUMAN (Q7Z4G4) Putative RNA methylase C6orf75 (EC 2.1.1.-)| Length = 463 Score = 32.0 bits (71), Expect = 1.1 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 322 HIYVAILYPSSELNVDAPNLLEDAVVFIARFCWILQASSSPSTNSLPPWTPCSHALS 492 H+ V++ Y S++ +D N + +V R + L + T + PW PC +S Sbjct: 340 HVPVSLSYHLSDMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVS 396
>CF075_MOUSE (Q9CWH5) Putative RNA methylase C6orf75 homolog (EC 2.1.1.-)| Length = 460 Score = 31.6 bits (70), Expect = 1.4 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = +1 Query: 322 HIYVAILYPSSELNVDAPNLLEDAVVFIARFCWILQASSSPSTNSLPPWTPCSHALS 492 H+ V++ Y S++ D N + +V R + L + T + PW PC +S Sbjct: 337 HVPVSLSYHLSDMFFDLLNFAAETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLRLIS 393
>TRIB1_HUMAN (Q96RU8) Tribbles homolog 1 (TRB-1) (SKIP1) (G-protein-coupled| receptor induced protein 2) (GIG-2) Length = 372 Score = 28.9 bits (63), Expect = 9.0 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 334 AILYPSSELNVDAPNLLE-DAVVFIARFCWILQASSSPSTNSLPPWTPCS 480 A+L+P++ V A LL+ D +A C L SSP PP +PCS Sbjct: 20 ALLFPATR-GVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCS 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,888,062 Number of Sequences: 219361 Number of extensions: 1198639 Number of successful extensions: 2405 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2399 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)