Clone Name | rbart36b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PKDRE_HUMAN (Q9NTG1) Polycystic kidney disease and receptor for ... | 32 | 1.1 | 2 | Y2115_VIBPA (P46231) Hypothetical protein VP2115 (ORF3) | 30 | 4.1 | 3 | HXK2_HUMAN (P52789) Hexokinase-2 (EC 2.7.1.1) (Hexokinase type I... | 30 | 5.3 | 4 | VPS16_YEAST (Q03308) Vacuolar protein sorting-associated protein... | 29 | 7.0 |
---|
>PKDRE_HUMAN (Q9NTG1) Polycystic kidney disease and receptor for egg jelly-related| protein precursor (PKD and REJ homolog) Length = 2253 Score = 32.0 bits (71), Expect = 1.1 Identities = 20/73 (27%), Positives = 41/73 (56%) Frame = +1 Query: 214 NLLDYALAFLEAIILPLIVRQTFVACFKFSDLKKFFPTRVSPVNFPPFHTSFQGLHLLER 393 NLL++AL + +++ L +R+ F+A + + +F+ + +P +F PFH Q H++ Sbjct: 1999 NLLNFALKCIFTVLIVLFLRKHFLA----TGIIRFYLS--NPEDFIPFHAVSQVDHIMRI 2052 Query: 394 LAWLFLAVTYNRT 432 + L +T +T Sbjct: 2053 ILGFLLFLTILKT 2065
>Y2115_VIBPA (P46231) Hypothetical protein VP2115 (ORF3)| Length = 441 Score = 30.0 bits (66), Expect = 4.1 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 194 VTFLS*LTPPVLFIFNLHPPSLPCVMCVCVPYVTTQFLFSPNGYVGLFLNH 42 + F+ L PP+L +F + CV + T ++ P G+ G+FLN+ Sbjct: 123 IAFIPILIPPLLGVFAKLKLDRRLIACVLTFGLITPYMVLPVGFGGIFLNN 173
>HXK2_HUMAN (P52789) Hexokinase-2 (EC 2.7.1.1) (Hexokinase type II) (HK II)| (Muscle form hexokinase) Length = 917 Score = 29.6 bits (65), Expect = 5.3 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -1 Query: 387 EEVQTLKTGMERRKVHWTDTCGKELFEIREFETSDEGLSDDEGENDGFKKCECVI 223 E V+ + M + ++ + EL FET D +SD EGE DG +K V+ Sbjct: 304 ELVRLILVKMAKEELLFGGKLSPELLNTGRFETKD--ISDIEGEKDGIRKAREVL 356
>VPS16_YEAST (Q03308) Vacuolar protein sorting-associated protein VPS16| Length = 798 Score = 29.3 bits (64), Expect = 7.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 274 QTFVACFKFSDLKKFFPTRVSPVNFPPFHT 363 +T V KF +L +F +R SP+ + PF+T Sbjct: 692 KTLVEAKKFDELLQFAQSRKSPIGYMPFYT 721 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,418,842 Number of Sequences: 219361 Number of extensions: 1316422 Number of successful extensions: 3826 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3821 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)