Clone Name | rbart36b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 p... | 50 | 5e-06 |
---|
>AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 precursor| Length = 252 Score = 49.7 bits (117), Expect = 5e-06 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = -1 Query: 511 SAGKIRLYGKLQLHSGMKAVNHIWQVGTSVTAGAPGKHAFAPGNLAS 371 S G+I ++ +++ +G +VN +WQ+G +VT G PG H F P NL S Sbjct: 139 SGGRIAIFTTVKVPAGADSVNQVWQIGGNVTNGRPGVHPFGPDNLGS 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,213,323 Number of Sequences: 219361 Number of extensions: 530637 Number of successful extensions: 1680 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1680 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)