ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart36a07 |
|---|---|
| Clone Library Name | barley_pub |
>SFRP3_BOVIN (Q95117) Secreted frizzled-related protein 3 precursor (sFRP-3)| (Frizzled-related protein 1) (FrzB-1) Length = 325 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 197 RPCASLPKRRWCLHRHRCFPAYMKYMYMYPSSLSC 93 +PC S+ +R R C P +KY + +P SL+C Sbjct: 106 KPCKSVCERA----RQGCEPILIKYRHSWPESLAC 136
>SFRP3_MOUSE (P97401) Secreted frizzled-related protein 3 precursor (sFRP-3)| (Frizzled-related protein 1) (FrzB-1) (Frezzled) (Fritz) Length = 323 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 197 RPCASLPKRRWCLHRHRCFPAYMKYMYMYPSSLSC 93 +PC S+ +R R C P +KY + +P SL+C Sbjct: 106 KPCKSVCERA----RQGCEPILIKYRHSWPESLAC 136
>SFRP3_CHICK (Q9IA95) Secreted frizzled-related protein 3 precursor (sFRP-3)| (Frizzled-related protein 1) (FrzB-1) Length = 315 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 8/65 (12%) Frame = -2 Query: 197 RPCASLPKRRWCLHRHRCFPAYMKYMYMYPSSLSCS*L--------IRPVSNNVPQDSCF 42 +PC S+ +R R C P ++Y + +P SL+C L I P + + + F Sbjct: 98 KPCKSVCERA----RAGCEPVLIRYRHAWPESLACDELPLYDRGVCISPEAIVTAEGADF 153 Query: 41 SMDDN 27 MD N Sbjct: 154 PMDSN 158
>STT3_SCHPO (O94335) Oligosaccharyl transferase stt3 subunit| Length = 752 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 262 RKLGATLFEGALTSDAVVFKYLDHVQAYPNVDGVCI 155 R G TL+ G + + ++FK L ++ N+ VC+ Sbjct: 88 RVAGGTLYPGLMVTSGIIFKVLHLLRINVNIRDVCV 123
>K1949_MACMU (Q5TM66) Protein KIAA1949 homolog| Length = 613 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 293 VSAGGGELQSEKVGRHAI*RSADQRCCGVQVPRP 192 V AG GE + E+ G A Q CC V P P Sbjct: 371 VEAGEGEAEKEEAGAQGRPLRALQNCCSVPSPLP 404
>K1949_HUMAN (Q6NYC8) Protein KIAA1949| Length = 613 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 293 VSAGGGELQSEKVGRHAI*RSADQRCCGVQVPRP 192 V AG GE + E+ G A Q CC V P P Sbjct: 371 VEAGEGEAEKEEAGAQGRPLRALQNCCSVPSPLP 404
>TPSDB_ABIGR (Q9M7C9) Limonene/alpha-pinene synthase, chloroplast precursor| ((-)-(4S)-limonene synthase) (EC 4.2.3.-) ((-)-(1S,5S)-alpha-pinene synthase) (Agg-pin2) Length = 637 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 173 RRWCLHRHRCFPAYMKYMYM 114 +RW L +C P YMK +YM Sbjct: 408 KRWDLSETKCLPEYMKAVYM 427
>SFRP3_PONPY (Q5RF67) Secreted frizzled-related protein 3 precursor (sFRP-3)| (Frizzled-related protein) (FrzB) Length = 325 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 197 RPCASLPKRRWCLHRHRCFPAYMKYMYMYPSSLSC 93 +PC S+ +R R C P +KY + +P +L+C Sbjct: 106 KPCKSVCERA----RQGCEPILIKYRHSWPENLAC 136
>SFRP3_HUMAN (Q92765) Secreted frizzled-related protein 3 precursor (sFRP-3)| (Frizzled-related protein 1) (FrzB-1) (Frezzled) (Fritz) Length = 325 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 197 RPCASLPKRRWCLHRHRCFPAYMKYMYMYPSSLSC 93 +PC S+ +R R C P +KY + +P +L+C Sbjct: 106 KPCKSVCERA----RQGCEPILIKYRHSWPENLAC 136
>THF1_SYNSC (Q3AJN7) Protein thf1| Length = 215 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 119 TYISCMQESNGGDANTIDVWVSLHMVEVLEHHS 217 TY S ++++ G D ++ W+S H ++ H+S Sbjct: 94 TYASLVEQAKGKDPESLKDWLSSHALKEGSHYS 126
>SPKF_SYNY3 (P73469) Serine/threonine-protein kinase F (EC 2.7.11.1)| Length = 495 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -3 Query: 307 RTKDELVQEVENFNQRKLGATLFEGALTSDAVVFKYLDHVQAYPNVD 167 +T ++ Q V+N K+ LF+GALT A+VF + V +P + Sbjct: 355 KTPGKISQAVQNLPVLKV---LFQGALTGSALVFWGIIAVSLFPQTN 398
>DLDH_ZYMMO (P50970) Dihydrolipoyl dehydrogenase (EC 1.8.1.4) (E3 component of| pyruvate and 2-oxoglutarate dehydrogenases complexes) (Dihydrolipoamide dehydrogenase) Length = 466 Score = 27.3 bits (59), Expect = 9.8 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -3 Query: 292 LVQEVENFNQRKLGATLFEGALTSDAVVFKYLDHVQAYPNVDGV-CIA 152 +V VEN KLG L G + D +DHV A +V G C+A Sbjct: 272 VVANVENIGLDKLGIKLDRGFIAVDGFGRTNVDHVWAIGDVAGAPCLA 319
>KCRM_TORMA (P00566) Creatine kinase M-type (EC 2.7.3.2) (Creatine kinase, M| chain) (M-CK) (NU-2 protein) Length = 381 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 54 LGYIVTHRSDKLGTREGGWIHIHIFHVCR 140 LGY++T S+ LGT G +H+ I H+C+ Sbjct: 277 LGYVLTCPSN-LGTGLRGGVHVKIPHLCK 304
>KCRM_TORCA (P04414) Creatine kinase M-type (EC 2.7.3.2) (Creatine kinase, M| chain) (M-CK) Length = 381 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 54 LGYIVTHRSDKLGTREGGWIHIHIFHVCR 140 LGY++T S+ LGT G +H+ I H+C+ Sbjct: 277 LGYVLTCPSN-LGTGLRGGVHVKIPHLCK 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,829,139 Number of Sequences: 219361 Number of extensions: 1107808 Number of successful extensions: 2602 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2602 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
