Clone Name | rbart35g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1841_MYCTU (Q50593) Hypothetical protein Rv1841c/MT1889 | 28 | 5.5 |
---|
>Y1841_MYCTU (Q50593) Hypothetical protein Rv1841c/MT1889| Length = 345 Score = 28.5 bits (62), Expect = 5.5 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 15 ILDRGKYIVGHGHAVDVMFLLHNPQALIVL 104 ++DRG +G+ H DV+ L NPQ +I L Sbjct: 254 VVDRGGRFIGYLHIKDVLTLGDNPQTVIDL 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,287,224 Number of Sequences: 219361 Number of extensions: 187304 Number of successful extensions: 766 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 80,573,946 effective HSP length: 10 effective length of database: 78,380,336 effective search space used: 1881128064 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)