Clone Name | rbart35e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ALR_FUSNN (Q8RGA2) Alanine racemase (EC 5.1.1.1) | 30 | 1.6 | 2 | TOP1_XENLA (P41512) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoi... | 29 | 3.6 | 3 | CYTSA_CHICK (Q2KN97) Cytospin-A | 28 | 6.2 | 4 | CSF1_YEAST (Q12150) Protein CSF1 (Cold sensitive for fermentatio... | 28 | 6.2 | 5 | HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor | 28 | 6.2 |
---|
>ALR_FUSNN (Q8RGA2) Alanine racemase (EC 5.1.1.1)| Length = 354 Score = 30.0 bits (66), Expect = 1.6 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +2 Query: 86 DHNTVATKNITLDQMTDTPIIQRQLNCEPKNISSS 190 D NT+ TKN TL+Q+ I LN E +IS+S Sbjct: 160 DGNTIETKNFTLEQIEKFKKIVNSLNLEYIHISNS 194
>TOP1_XENLA (P41512) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 829 Score = 28.9 bits (63), Expect = 3.6 Identities = 18/57 (31%), Positives = 24/57 (42%) Frame = +1 Query: 19 HSTVHPNLLHHRNSWDTTKHNARPQHSSNEKHNARPDDGHADNSKTAKL*AQKHKQL 189 H H N HR D KH R EKH + + H D K + +KHK++ Sbjct: 59 HKDKHKNNDKHREK-DGEKHRER----DGEKHRDKNGEKHRDGEKHKEKDIEKHKEV 110
>CYTSA_CHICK (Q2KN97) Cytospin-A| Length = 1118 Score = 28.1 bits (61), Expect = 6.2 Identities = 15/66 (22%), Positives = 29/66 (43%) Frame = +2 Query: 41 CCTTEIHGTQPNITLDHNTVATKNITLDQMTDTPIIQRQLNCEPKNISSSMAKHLQATTE 220 C T IH + N H+T TL ++ D I ++LN E + + +++ + Sbjct: 396 CLTERIHQMEEN---QHSTAEELQATLQELADLQQITQELNSENERLGEEKVILMESLCQ 452 Query: 221 AEHQVE 238 ++E Sbjct: 453 QSDKLE 458
>CSF1_YEAST (Q12150) Protein CSF1 (Cold sensitive for fermentation protein 1)| Length = 2958 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/72 (22%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +2 Query: 44 CTTEIHGTQPNI--TLDHNTVATKNITLDQMTDTPIIQRQLNCEPKNISSSMAKHLQATT 217 C +HG + +I T+ ++ + TP+ + LN P N + KH + Sbjct: 661 CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720 Query: 218 EAEHQVEGRLLL 253 + ++G LL Sbjct: 721 AYDFTIKGSYLL 732
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 10 LFIHSTVHPNLLHHRNSWDTTKHNARPQHSSNEKHNARPDDGH 138 + + TVHP LH + + + P H E H+ P++ H Sbjct: 46 VLVEDTVHPEHLHEEHHHHHPEEHHEPHH--EEHHHHHPEEHH 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,513,851 Number of Sequences: 219361 Number of extensions: 392654 Number of successful extensions: 1422 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1412 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)