Clone Name | rbart35e10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RGS19_RAT (O70521) Regulator of G-protein signaling 19 (RGS19) (... | 29 | 6.9 | 2 | RGS19_MOUSE (Q9CX84) Regulator of G-protein signaling 19 (RGS19) | 29 | 6.9 | 3 | YIJF_ECOLI (P32668) Hypothetical protein yijF precursor | 29 | 9.0 | 4 | SCR11_ARATH (P82630) Hypothetical protein SCRL11 precursor | 29 | 9.0 |
---|
>RGS19_RAT (O70521) Regulator of G-protein signaling 19 (RGS19)| (G-alpha-interacting protein) (GAIP protein) Length = 216 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 418 ADEPPWTNTTNPCPSEGPSTGHCTELATPSRAV*CWCLCGNIHW 287 AD PP ++ + PS PS C CWC C + W Sbjct: 17 ADRPPSMSSHDAAPSGPPSRNPCCL---------CWCCCCSCSW 51
>RGS19_MOUSE (Q9CX84) Regulator of G-protein signaling 19 (RGS19)| Length = 216 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 418 ADEPPWTNTTNPCPSEGPSTGHCTELATPSRAV*CWCLCGNIHW 287 AD PP ++ + PS PS C CWC C + W Sbjct: 17 ADRPPSMSSHDAAPSGPPSRNPCCL---------CWCCCCSCSW 51
>YIJF_ECOLI (P32668) Hypothetical protein yijF precursor| Length = 205 Score = 28.9 bits (63), Expect = 9.0 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -1 Query: 411 NRLGQTPPTHVRPKGHQRAIAPSWRRLQGLYNVGVCVATFIGTGAFLFIY 262 +R +T PT P +Q SWR GL ++GV F G L I+ Sbjct: 130 SRHDKTRPTSKNPSDYQAGDIVSWRLDNGLAHIGVVSDGFARDGTPLVIH 179
>SCR11_ARATH (P82630) Hypothetical protein SCRL11 precursor| Length = 86 Score = 28.9 bits (63), Expect = 9.0 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = -3 Query: 481 MLGPSGLLQNCVSTILLGVYFADEPPWTNTTNPCPSEGPSTGHCTELATPS 329 M G + LL +C+ L A E W CPS+ G CT+ +PS Sbjct: 1 MKGIAMLLVSCLLFSFLSTNLAKELKW------CPSKDVFNGSCTDTGSPS 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,410,709 Number of Sequences: 219361 Number of extensions: 1757656 Number of successful extensions: 4065 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4065 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)