| Clone Name | rbart35b08 |
|---|---|
| Clone Library Name | barley_pub |
>VPS4B_HUMAN (O75351) Vacuolar sorting protein 4b (SKD1 protein)| Length = 444 Score = 39.3 bits (90), Expect = 0.006 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 478 DMWMPCGSKQPGAVQTTMQDLASKGLASQILPPPISKSDFEKVLARQRPTVGKKDL 311 D+ PC PGA++ T D+ ++L P +S SD + L+ +PTV + DL Sbjct: 379 DLLTPCSPGDPGAIEMTWMDVP----GDKLLEPVVSMSDMLRSLSNTKPTVNEHDL 430
>VPS4A_MOUSE (Q8VEJ9) Vacuolar sorting protein 4a| Length = 437 Score = 38.5 bits (88), Expect = 0.010 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = -1 Query: 478 DMWMPCGSKQPGAVQTTMQDLASKGLASQILPPPISKSDFEKVLARQRPTVGKKDL 311 D+ PC PGA++ T D+ ++L P + SD + LA RPTV DL Sbjct: 372 DLLTPCSPGDPGAIEMTWMDVP----GDKLLEPVVCMSDMLRSLATTRPTVNADDL 423
>VPS4A_HUMAN (Q9UN37) Vacuolar sorting protein 4a (SKD2 protein) (hVPS4)| (VPS4-1) Length = 437 Score = 37.7 bits (86), Expect = 0.017 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = -1 Query: 478 DMWMPCGSKQPGAVQTTMQDLASKGLASQILPPPISKSDFEKVLARQRPTVGKKDL 311 D+ PC PGA++ T D+ ++L P + SD + LA RPTV DL Sbjct: 372 DLLTPCSPGDPGAMEMTWMDVP----GDKLLEPVVCMSDMLRSLATTRPTVNADDL 423
>VPS4B_MOUSE (P46467) Vacuolar sorting protein 4b (SKD1 protein)| Length = 444 Score = 37.0 bits (84), Expect = 0.029 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = -1 Query: 478 DMWMPCGSKQPGAVQTTMQDLASKGLASQILPPPISKSDFEKVLARQRPTVGKKDL 311 D+ PC PGA++ T D+ ++L P +S D + L+ +PTV ++DL Sbjct: 379 DLLTPCSPGDPGAIEMTWMDVP----GDKLLEPVVSMWDMLRSLSSTKPTVNEQDL 430
>CEMA_CHAGL (Q8M9X3) Chloroplast envelope membrane protein| Length = 472 Score = 33.9 bits (76), Expect = 0.24 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 12/87 (13%) Frame = -3 Query: 257 QPRELSRPMHSRTTEMYIVYNFDS----LRLGVKFADLYTLVA--------LTVLNVWRR 114 QP++L +H RT ++ YN DS L L F ++TL+ L +LN W Sbjct: 323 QPQDLGALIHQRTIQLAEYYNQDSINIILHLFTDFIAIFTLIVLLILGKKRLAILNSW-- 380 Query: 113 RQPCYAGLSLCLCCQLYFTYTLLCLEF 33 Q + L+ + L +T LC+ F Sbjct: 381 VQEVFYSLTDTMKAFLILLFTDLCIGF 407
>VPS4_YEAST (P52917) Vacuolar protein sorting-associated protein VPS4 (END13| protein) (DOA4-independent degradation protein 6) Length = 437 Score = 32.3 bits (72), Expect = 0.71 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -1 Query: 466 PCGSKQPGAVQTTMQDLASKGLASQILPPPISKSDFEKVLARQRPTVGKKDL 311 PC GA++ + D+ A ++ P ++ DF K + RPTV + DL Sbjct: 375 PCSPGDDGAIEMSWTDIE----ADELKEPDLTIKDFLKAIKSTRPTVNEDDL 422
>PTK6_HUMAN (Q13882) Tyrosine-protein kinase 6 (EC 2.7.10.2) (Breast tumor| kinase) (Tyrosine-protein kinase BRK) Length = 451 Score = 32.3 bits (72), Expect = 0.71 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -3 Query: 422 GSCIQRPCLTDSPTPNLEERFREGPREAETDCRQEGPGGAREVHQGVWR 276 G + PC P P E PRE T CR+ G G EV +G+W+ Sbjct: 163 GLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLWK 211
>ZNHI4_MOUSE (Q99PT3) Zinc finger HIT domain-containing protein 4| (PAP-1-associated protein 1) (PAPA-1) (High mobility group AT-hook 1-like 4) Length = 345 Score = 30.4 bits (67), Expect = 2.7 Identities = 20/55 (36%), Positives = 23/55 (41%) Frame = +1 Query: 217 VVRLCMGRESSRGCVPLSPPRQTPW*TSRAPPGPSCRQSVSASRGPSRNRSSRLG 381 +VR C G + S P P T AP GP+ R SV P R SR G Sbjct: 261 MVRYCSGAQGSTLSFPPGVPTPTAVAQRPAPSGPAPRCSVPGCPHPRRYACSRTG 315
>ECLC_BOVIN (P54281) Epithelial chloride channel protein (Calcium-activated| chloride channel) Length = 903 Score = 30.4 bits (67), Expect = 2.7 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 9/51 (17%) Frame = -3 Query: 458 IEATRCCADH---------DAGSCIQRPCLTDSPTPNLEERFREGPREAET 333 IEATRC GSCI RPC DS T E + P +++T Sbjct: 182 IEATRCSTHITGTNVIVKCQGGSCITRPCRRDSQTGLYEAKCTFIPEKSQT 232
>MASS1_MOUSE (Q8VHN7) Monogenic audiogenic seizure susceptibility protein 1| precursor (Very large G-protein coupled receptor 1) (Neurepin) Length = 6298 Score = 30.4 bits (67), Expect = 2.7 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +3 Query: 219 GAAVHGSREFSRLRTTQPSSPNSLVNFSCTSR 314 GAA++ S F+ ++ ++ +P SLV+FS SR Sbjct: 5467 GAAINNSARFAPIKLSKSGAPQSLVSFSVGSR 5498
>DYN1_HUMAN (Q05193) Dynamin-1 (EC 3.6.5.5)| Length = 864 Score = 29.6 bits (65), Expect = 4.6 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 262 PLSPPRQTPW*TSRAPPGPSCRQSVSASRGPSRNRSSR 375 P PP Q P +RAPPG R S PSR S R Sbjct: 825 PFGPPPQVPSRPNRAPPGVPSR---SGQASPSRPESPR 859
>BAG3_MOUSE (Q9JLV1) BAG family molecular chaperone regulator 3 (BCL-2-binding| athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) Length = 577 Score = 29.3 bits (64), Expect = 6.0 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 277 RQTPW*TSRAPP-GPSCRQSVSASRGPSRNRSSRLGVGE 390 R T W R PP GP + + S++ GPSRN S L + E Sbjct: 47 RTTTWNDPRVPPEGP--KDTASSANGPSRNGSRLLPIRE 83
>TOM40_MOUSE (Q9QYA2) Probable mitochondrial import receptor subunit TOM40| homolog (Translocase of outer membrane 40 kDa subunit homolog) Length = 359 Score = 29.3 bits (64), Expect = 6.0 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +1 Query: 232 MGRESSRGCVPLSPPRQTPW*TSRAPPGPS-----CRQSVSASRGPSRNRSS 372 MG + P PP TP PP PS CR+S + G S R S Sbjct: 1 MGNVLAASSPPARPPPPTPSLVGLPPPPPSPPRSLCRRSAALGTGSSTGRGS 52
>VPS4_SCHPO (Q09803) Suppressor protein of bem1/bed5 double mutants| Length = 432 Score = 28.9 bits (63), Expect = 7.8 Identities = 14/63 (22%), Positives = 31/63 (49%) Frame = -1 Query: 490 KTDGDMWMPCGSKQPGAVQTTMQDLASKGLASQILPPPISKSDFEKVLARQRPTVGKKDL 311 K++ + PC P A +++ ++ + I+ P ++ DF + + +PT+ D+ Sbjct: 363 KSNRTLVTPCSPGDPDAFESSWLEVNPE----DIMEPKLTVRDFYSAVRKVKPTLNAGDI 418 Query: 310 EVH 302 E H Sbjct: 419 EKH 421
>WIRE_MOUSE (Q6PEV3) WIP-related protein (WASP-interacting protein-related| protein) Length = 440 Score = 28.9 bits (63), Expect = 7.8 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 223 RLCMGRESSRGCVPLSPP------RQTPW*TSRAPPGPSCRQSVSASRGPS 357 RL GRE P+ PP R P S APP P RQ GPS Sbjct: 216 RLHPGREGHPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPS 266
>WIRE_HUMAN (Q8TF74) WIP-related protein (WASP-interacting protein-related| protein) (WIP-and CR16-homologous protein) Length = 440 Score = 28.9 bits (63), Expect = 7.8 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 223 RLCMGRESSRGCVPLSPP------RQTPW*TSRAPPGPSCRQSVSASRGPS 357 RL GRE P+ PP R P S APP P RQ GPS Sbjct: 216 RLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPS 266
>PHO4_NEUCR (P15710) Phosphate-repressible phosphate permease| Length = 590 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 124 YGDDGSLVMLGYHCASVVNSISLTL 50 + DD +L+MLG CA V +SI LT+ Sbjct: 80 FADDPALLMLGMVCAVVASSIYLTM 104
>CEMA_MARPO (P12211) Chloroplast envelope membrane protein| Length = 434 Score = 28.9 bits (63), Expect = 7.8 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 12/87 (13%) Frame = -3 Query: 257 QPRELSRPMHSRTTEMYIVYNFDSLRLGVK-FADLYTLVALT-----------VLNVWRR 114 Q ++L++ +H +T E+ +YN DS+++ + DL + L+ +LN W Sbjct: 285 QLQDLTKEIHQQTIELVQIYNNDSIKIVLHLLTDLIWFITLSCLFILGKERLVILNSW-- 342 Query: 113 RQPCYAGLSLCLCCQLYFTYTLLCLEF 33 Q + LS + T LC+ F Sbjct: 343 AQELFYSLSDTMKAFFILLLTDLCIGF 369 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,590,927 Number of Sequences: 219361 Number of extensions: 1650823 Number of successful extensions: 5375 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 5078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5369 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)