Clone Name | rbart35a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MRAY_PARUW (Q6MBS3) Phospho-N-acetylmuramoyl-pentapeptide-transf... | 28 | 5.6 | 2 | DPO1_THEFI (O52225) DNA polymerase I, thermostable (EC 2.7.7.7) ... | 28 | 5.6 | 3 | DPOE_USTMA (Q4PFV5) DNA polymerase epsilon, catalytic subunit A ... | 28 | 5.6 |
---|
>MRAY_PARUW (Q6MBS3) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 410 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 204 FSTWVWGIDPALKTQIINRLQKSVRQLGSLIKVIGLQNGA 323 F W W P +K QI+ + ++++++ S K I L+ A Sbjct: 163 FEKWTWFQPPVIKEQIVVKNSETLQEMPSQTKSISLKEYA 202
>DPO1_THEFI (O52225) DNA polymerase I, thermostable (EC 2.7.7.7) (TFI| polymerase 1) Length = 833 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 195 HTRFSTWVWGIDPALKTQIINRLQKSV 275 HT + W++G+DPAL + R K+V Sbjct: 639 HTETAAWMFGLDPALVDPKMRRAAKTV 665
>DPOE_USTMA (Q4PFV5) DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7)| (DNA polymerase II subunit A) Length = 2305 Score = 28.1 bits (61), Expect = 5.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 227 DPPNPGGESGMGIYIVHTSVRMYKMLQFHMP 135 DP +P G+SG+ Y + M+K + P Sbjct: 99 DPDHPTGKSGVDFYFIEDDASMFKATVLYQP 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,644,504 Number of Sequences: 219361 Number of extensions: 850480 Number of successful extensions: 1907 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1907 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)