| Clone Name | rbart34g02 |
|---|---|
| Clone Library Name | barley_pub |
>INVA_PHAAU (P29001) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) [Contains: Acid beta-fructofuranosidase 30 kDa subunit; Acid beta-fructofuranosidase 38 kDa subunit] Length = 649 Score = 32.3 bits (72), Expect = 0.29 Identities = 20/77 (25%), Positives = 33/77 (42%) Frame = +1 Query: 25 LVFTGAISSVHHYNLTGGPNGHILSMGINRKVCEQS*TKIQVSAWTTAIRVLTIGSKSMS 204 L+F ++ + Y +G P+ H+ S N + QS T + S W R ++ G S Sbjct: 31 LLFLSSLVAYGGYRASGVPHAHLSSPTSNHQQDHQSPTSLPSSKWYPVSRGVSSGVSEKS 90 Query: 205 RQINRGSVGA*SATFPF 255 + G S FP+ Sbjct: 91 SNLLFAGEGGASEAFPW 107
>MDM20_YEAST (Q12387) N-terminal acetyltransferase B complex subunit MDM20 (NatB| complex subunit MDM20) (Mitochondrial distribution and morphology protein 20) (Dislikes extra CIN8 protein 1) Length = 796 Score = 31.6 bits (70), Expect = 0.49 Identities = 22/83 (26%), Positives = 38/83 (45%) Frame = +3 Query: 126 TKLNEDTSISLDYRNPRSDHRKQINEPSN*PGVCGCLKCNLPFQIDRRELLFHILPGTYR 305 T N DTS++L +N H K +N P VC L + +D EL+ +++ Y+ Sbjct: 220 TFANFDTSVNLYLKNFILKHTKLLNSPQKLFEVCSKL---IEKGLDDYELITNLIDAAYK 276 Query: 306 RITMSIGGFSKVAQWLERRIGSN 374 +V QW++ +G + Sbjct: 277 LSKSK----DEVKQWIDENLGDS 295
>YMN1_YEAST (Q03102) Hypothetical 40.0 kDa protein in COX14-COS3 intergenic| region Length = 365 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -2 Query: 374 IASDATLKPLGHFAEAPNAHSYPPICAGEYVEQELSAINLK 252 +A LK L E N H + P C E +E+ELS+ LK Sbjct: 3 LAKQWVLKNLPTPGEPFNFHFHDPACTFELIEKELSSEQLK 43
>SYV_PSEAE (Q9HXH0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 950 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 353 KPLGHFAEAPNAHSYPPICAGEYVEQE 273 K +G FAE P + PI A EYV++E Sbjct: 241 KLIGQFAELPIVGRHIPIIADEYVDRE 267
>INVA_PHAVU (O24509) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 651 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/77 (23%), Positives = 31/77 (40%) Frame = +1 Query: 25 LVFTGAISSVHHYNLTGGPNGHILSMGINRKVCEQS*TKIQVSAWTTAIRVLTIGSKSMS 204 L+F ++ + + P+ H+ S N + QS T + S W R ++ G S Sbjct: 31 LLFLSSLVAFGRNRASNVPHDHVSSSASNHQQEHQSPTSLPSSKWHAVSRGVSSGVSEKS 90 Query: 205 RQINRGSVGA*SATFPF 255 + G S FP+ Sbjct: 91 SSMLFSGEGGASEAFPW 107
>RL18_METKA (Q8TZA5) 50S ribosomal protein L18P| Length = 202 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 309 SAYMCRGVCGTRALGDQFEREGCTLGTHRP 220 +AY+ +CG RAL ER +G HRP Sbjct: 85 AAYLTGYLCGLRALERGIERAVIDIGLHRP 114
>KIF4A_CHICK (Q90640) Chromosome-associated kinesin KIF4A (Chromokinesin)| Length = 1225 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 297 CRGVCGTRALGDQFEREGCTLG 232 C+G CG R G + ++ GCT G Sbjct: 1086 CKGRCGNRQCGCRKQKVGCTAG 1107
>GGA1_HUMAN (Q9UJY5) ADP-ribosylation factor-binding protein GGA1| (Golgi-localized, gamma ear-containing, ARF-binding protein 1) (Gamma-adaptin-related protein 1) Length = 639 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 371 ASDATLKPLGHFAEAPNAHSYPPICAGEYVEQELSAINLKGKVAL 237 +SDAT P A+AP+ S PP L ++L GK L Sbjct: 387 SSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLL 431
>SYV_THEMA (Q9X2D7) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 865 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -2 Query: 356 LKPLGHFAEAPNAHSYPPICAGEYVEQELSA-INLKGKV 243 LK LG+ E + PP A YVE+E+ A ++L G + Sbjct: 761 LKTLGNIEEVSFVNEKPPKTATAYVEEEIEAYVDLGGLI 799 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,179,701 Number of Sequences: 219361 Number of extensions: 1061471 Number of successful extensions: 1969 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1969 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)