Clone Name | rbart34f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DEOD_ERWCT (Q6D989) Purine nucleoside phosphorylase deoD-type (E... | 29 | 8.2 | 2 | UNC18_CAEEL (P34815) Putative acetylcholine regulator unc-18 (Un... | 29 | 8.2 |
---|
>DEOD_ERWCT (Q6D989) Purine nucleoside phosphorylase deoD-type (EC 2.4.2.1)| (PNP) Length = 239 Score = 28.9 bits (63), Expect = 8.2 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = -2 Query: 498 ACLQKRTEVKLQDLPVVLGACCVLHNICEARGEAMTPELRVEVQDDLPVLD-NPVRSA-D 325 +C R +VKL+D+ + +GAC ++ +R + D + D + VR+A D Sbjct: 91 SCGAVREDVKLRDVVIGMGACT----------DSKVNRMRFKDHDYAAIADFDMVRNAVD 140 Query: 324 AAKARD 307 AAKARD Sbjct: 141 AAKARD 146
>UNC18_CAEEL (P34815) Putative acetylcholine regulator unc-18 (Uncoordinated| protein 18) Length = 591 Score = 28.9 bits (63), Expect = 8.2 Identities = 20/69 (28%), Positives = 34/69 (49%) Frame = -2 Query: 450 VLGACCVLHNICEARGEAMTPELRVEVQDDLPVLDNPVRSADAAKARDKMAHNLLHRGLA 271 +L +CC +HNI E G + +L + ++ LP L+ A A++ DK+ + R L Sbjct: 40 MLSSCCKMHNIME-EGITIVEDLN-KRREPLPTLEAIYLIAPTAESIDKLIQDYCARNLY 97 Query: 270 GTAFF*FAD 244 A F + Sbjct: 98 KCAHVFFTE 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,985,080 Number of Sequences: 219361 Number of extensions: 745849 Number of successful extensions: 2193 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2193 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)