| Clone Name | rbart34e09 |
|---|---|
| Clone Library Name | barley_pub |
>V2R_RAT (Q00788) Vasopressin V2 receptor (Renal-type arginine vasopressin| receptor) (Antidiuretic hormone receptor) (AVPR V2) Length = 371 Score = 31.2 bits (69), Expect = 0.72 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -2 Query: 207 HVAGSVLETADPSTTIVKLYLRTTLPCFLFRFWICFCFDRPIRKPP 70 HV+ ++ +T + IV +Y+ P FL + W + + P+ +PP Sbjct: 261 HVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEAPLERPP 306
>V2R_MOUSE (O88721) Vasopressin V2 receptor (Renal-type arginine vasopressin| receptor) (Antidiuretic hormone receptor) (AVPR V2) Length = 371 Score = 31.2 bits (69), Expect = 0.72 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -2 Query: 207 HVAGSVLETADPSTTIVKLYLRTTLPCFLFRFWICFCFDRPIRKPP 70 HV+ ++ +T + IV +Y+ P FL + W + + P+ +PP Sbjct: 261 HVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEAPLERPP 306
>LTBP4_MOUSE (Q8K4G1) Latent transforming growth factor beta-binding protein 4| precursor (LTBP-4) Length = 1666 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 214 PPPCG-GLCFGDGRSFHHHCKTLFTNHPPLFPISFLD 107 PPPCG G C SFH C F + P P +D Sbjct: 761 PPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVD 797
>PYR1_FREDI (P18542) Phycobilisome 31.8 kDa linker polypeptide,| phycoerythrin-associated, rod Length = 285 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 24 YRSKTFVYIQNYNRTGGVSLLVYQNKNKSKNEIGNKGG 137 YR+KTF I + R+ V L+ Y+ ++ I +GG Sbjct: 240 YRAKTFNNISKFRRSNQVFLVPYEKLSQEYQRIHQQGG 277
>XG_HUMAN (P55808) Glycoprotein Xg precursor (Protein PBDX)| Length = 180 Score = 28.1 bits (61), Expect = 6.1 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +3 Query: 123 GNKGGWFVNKVLQWWWKDLPSPKQSPPHGGGTNGRS 230 GN GG+F N V + + P P+ PP GGG G S Sbjct: 81 GNSGGYF-NDVDRDDGRYPPRPRPRPPAGGGGGGYS 115
>V2R_HUMAN (P30518) Vasopressin V2 receptor (Renal-type arginine vasopressin| receptor) (Antidiuretic hormone receptor) (AVPR V2) Length = 371 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -2 Query: 207 HVAGSVLETADPSTTIVKLYLRTTLPCFLFRFWICFCFDRPIRKPP 70 HV+ +V +T + IV +Y+ P FL + W + + P+ P Sbjct: 261 HVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAP 306
>SSG2_PEA (Q43093) Granule-bound starch synthase 2, chloroplast precursor (EC| 2.4.1.21) (Granule-bound starch synthase II) (GBSS-II) Length = 752 Score = 27.7 bits (60), Expect = 7.9 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -1 Query: 208 PCGGLCFGDG 179 PCGG+C+GDG Sbjct: 382 PCGGICYGDG 391 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,529,248 Number of Sequences: 219361 Number of extensions: 975880 Number of successful extensions: 2328 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2327 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)