ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart34a05 |
|---|---|
| Clone Library Name | barley_pub |
>ADT2_MAIZE (P12857) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 387 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YDQLQILFFGKKYGSGGA Sbjct: 370 YDQLQILFFGKKYGSGGA 387
>ADT1_MAIZE (P04709) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 387 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YDQLQILFFGKKYGSGGA Sbjct: 370 YDQLQILFFGKKYGSGGA 387
>ADT_ORYSA (P31691) ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP| translocase) (Adenine nucleotide translocator) (ANT) Length = 382 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YDQLQILFFGKKYGSGGA Sbjct: 365 YDQLQILFFGKKYGSGGA 382
>ADT2_WHEAT (Q41630) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 331 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YDQLQILFFGKKYGSGGA Sbjct: 314 YDQLQILFFGKKYGSGGA 331
>ADT1_WHEAT (Q41629) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 331 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YDQLQILFFGKKYGSGGA Sbjct: 314 YDQLQILFFGKKYGSGGA 331
>ADT1_GOSHI (O22342) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 386 Score = 35.8 bits (81), Expect = 0.025 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YD+LQ++ FGKKYGSGGA Sbjct: 369 YDKLQLIVFGKKYGSGGA 386
>ADT2_ARATH (P40941) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 385 Score = 35.8 bits (81), Expect = 0.025 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YD+LQ++ FGKKYGSGGA Sbjct: 368 YDKLQLIVFGKKYGSGGA 385
>ADT1_ARATH (P31167) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 381 Score = 35.8 bits (81), Expect = 0.025 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YD+LQ++ FGKKYGSGGA Sbjct: 364 YDKLQLIVFGKKYGSGGA 381
>ADT2_SOLTU (P27081) ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP| translocase) (Adenine nucleotide translocator) (ANT) (Fragment) Length = 386 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGG 339 YD+LQ++ FGKKYGSGG Sbjct: 369 YDKLQVIVFGKKYGSGG 385
>RA6I1_HUMAN (Q6IQ26) Rab6-interacting protein 1 (Rab6IP1)| Length = 1287 Score = 33.9 bits (76), Expect = 0.097 Identities = 23/78 (29%), Positives = 33/78 (42%) Frame = +2 Query: 122 LNPMIVNVLRTLPPTYDNLWSSMPPPKTNVGKIHPLQKLLPSNVKKINVRQILEGQDWEQ 301 L ++V L T P D PP + + I L + P+N K+N QI E Sbjct: 1057 LERILVGELLTSQPEVDERPCRTPPLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAV 1116 Query: 302 TSLVRHHFFPSRHRLSRT 355 +V+H P + R S T Sbjct: 1117 NGIVKHFHKPEKERGSLT 1134
>ADT1_SOLTU (P25083) ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP| translocase) (Adenine nucleotide translocator) (ANT) Length = 386 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YD+LQ+L GKK+GSGGA Sbjct: 369 YDKLQVLVLGKKFGSGGA 386
>RA6I1_MOUSE (Q6PAL8) Rab6-interacting protein 1 (Rab6IP1)| Length = 1287 Score = 33.1 bits (74), Expect = 0.17 Identities = 23/78 (29%), Positives = 33/78 (42%) Frame = +2 Query: 122 LNPMIVNVLRTLPPTYDNLWSSMPPPKTNVGKIHPLQKLLPSNVKKINVRQILEGQDWEQ 301 L ++V L T P D PP + + I L + P+N K+N QI E Sbjct: 1057 LERVLVGELLTSLPEVDERPCRTPPLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAV 1116 Query: 302 TSLVRHHFFPSRHRLSRT 355 +V+H P + R S T Sbjct: 1117 NGIVKHFHKPEKERGSLT 1134
>ADT_CHLRE (P27080) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 308 Score = 32.7 bits (73), Expect = 0.22 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 389 YDQLQILFFGKKYGSGGA 336 YDQLQ++ GKKYGSG A Sbjct: 291 YDQLQVILLGKKYGSGEA 308
>POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3471 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 180 GVRCLHQKRMLGKSTLYRNYC 242 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>POLG_RTSVA (Q83034) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3473 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 180 GVRCLHQKRMLGKSTLYRNYC 242 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>HM2L1_HUMAN (Q9UGU5) High mobility group protein 2-like 1 (HMGBCG protein)| Length = 601 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 20 HQQDKLDHNLSRIRGQCI*GKLPSNDSGHILELKLNPMIVN 142 H + K +H+ ++ G G+LP D G K+ P+ VN Sbjct: 140 HSESKKEHHRKKVSGSS--GELPLEDGGSHKSKKMKPLYVN 178
>MURG_RICTY (Q68WW7) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 385 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 6/43 (13%) Frame = -1 Query: 303 VCSQSCPSRIWRTFI------FLTLEGNNFCRGWIFPTFVFGG 193 + SQ CP+++ +T + F+ N F IF F+FGG Sbjct: 172 LASQHCPTKLTKTVLTNTLNHFVKARNNKFSNCNIFTLFIFGG 214
>RBL_METMA (Q8PXG9) Ribulose bisphosphate carboxylase (EC 4.1.1.39) (RuBisCO)| Length = 428 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +2 Query: 41 HNLSRIRGQCI*GKLPSNDSGHILELK---LNPMIVNVLRTLPPT 166 H + +R QC+ K+P+++S HIL L PM L PT Sbjct: 316 HEVLNLRDQCVLDKVPADESQHILAQDWRGLKPMFPVASGGLAPT 360
>LEPA_AGRT5 (Q8UIQ2) GTP-binding protein lepA| Length = 608 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 155 LPPTYDNLWSSMPPPKTNVGKIHPLQKLL 241 +P + + + +PPPK++VG+ PL+ LL Sbjct: 178 IPDVLEAIVNRLPPPKSDVGENGPLKALL 206
>RPOC1_GRATL (Q6B8R7) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta' subunit) (RNA polymerase beta' subunit) Length = 628 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 221 HPLQKLLPSNVKKINVRQILEGQDW 295 H + P N K+N +Q+LEG +W Sbjct: 142 HSYVVINPGNYHKLNYKQLLEGYEW 166
>ABR18_PEA (Q06930) ABA-responsive protein ABR18| Length = 158 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 164 TYDN-LWSSMPPPKTNVGKIHPLQKLLPSNVKKINVRQILEG 286 TY+N S++PP K +H ++P V I +ILEG Sbjct: 5 TYENDTTSTVPPAKLFKAVVHDADLIVPKVVDSIKTVEILEG 46
>LV4D_HUMAN (P01718) Ig lambda chain V-IV region Kern| Length = 106 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 246 EGNNFCRGWIFPTFVFGGGIELQRLS 169 E + FC+ W T +FGGG +L LS Sbjct: 81 EADYFCQTWDTITAIFGGGTKLTVLS 106
>APOA4_MOUSE (P06728) Apolipoprotein A-IV precursor (Apo-AIV) (ApoA-IV)| Length = 395 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 110 LELKLNPMIVNVLRTLPPTYDNLWSSMPPPKTNV 211 ++L+L P I + T+ DNL +SM P TN+ Sbjct: 153 MKLQLTPYIQRMQTTIKENVDNLHTSMMPLATNL 186
>KV6A_MOUSE (P01675) Ig kappa chain V-VI region XRPC 44| Length = 107 Score = 27.3 bits (59), Expect = 9.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 234 FCRGWIFPTFVFGGGIELQ 178 +C+ W +P + FGGG +L+ Sbjct: 86 YCQQWNYPLWTFGGGTKLE 104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,490,434 Number of Sequences: 219361 Number of extensions: 1406869 Number of successful extensions: 3877 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 3806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3877 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
