Clone Name | rbart33h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRIM5_HUMAN (Q9C035) Tripartite motif protein 5 (EC 6.3.2.-) (RI... | 29 | 6.4 | 2 | P2RY6_RAT (Q63371) P2Y purinoceptor 6 (P2Y6) | 29 | 6.4 | 3 | CATV_GVXN (Q9PYY5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cyst... | 29 | 8.3 |
---|
>TRIM5_HUMAN (Q9C035) Tripartite motif protein 5 (EC 6.3.2.-) (RING finger| protein 88) Length = 493 Score = 29.3 bits (64), Expect = 6.4 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 15 PQVSFRVERGTRFQKILSSNKCTNLLGIQYAATTK 119 PQ+ + RGTR+Q ++ N CT +LG Q + K Sbjct: 325 PQIIYGA-RGTRYQTFVNFNYCTGILGSQSITSGK 358
>P2RY6_RAT (Q63371) P2Y purinoceptor 6 (P2Y6)| Length = 328 Score = 29.3 bits (64), Expect = 6.4 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -1 Query: 241 ASIYSSIL----LKFIAVDFVCFYISQYKLLGG*EAGFILCCIGYFVVAAYCMPS 89 A+++ SIL + F +C ++ + GG A +++C + + VV A C+P+ Sbjct: 108 ANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWVVCGVVWLVVTAQCLPT 162
>CATV_GVXN (Q9PYY5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 346 Score = 28.9 bits (63), Expect = 8.3 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = -1 Query: 331 MLIKWALCVSHLTINM*CMACYSGHKMDLLASIYSSILLKF 209 M + W CV+ LT+N+ C Y + M +++ ++K+ Sbjct: 11 MFLPWVFCVALLTLNV-CAVSYIAYDMSNAQELFNEFVVKY 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,577,087 Number of Sequences: 219361 Number of extensions: 1241119 Number of successful extensions: 2385 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2385 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)