| Clone Name | rbart33g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZNF41_HUMAN (P51814) Zinc finger protein 41 | 30 | 3.2 | 2 | Z585A_PONPY (Q5RDX1) Zinc finger protein 585A | 29 | 5.5 | 3 | Z585B_PONPY (Q5RB30) Zinc finger protein 585B | 28 | 9.4 | 4 | Z585B_HUMAN (Q52M93) Zinc finger protein 585B (zinc finger prote... | 28 | 9.4 | 5 | PFA3_YARLI (Q6C4W5) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Prot... | 28 | 9.4 | 6 | ZN200_HUMAN (P98182) Zinc finger protein 200 | 28 | 9.4 |
|---|
>ZNF41_HUMAN (P51814) Zinc finger protein 41| Length = 821 Score = 30.0 bits (66), Expect = 3.2 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = +2 Query: 2 HGRITYG*HANRCTNQSKKVQGR*VQLVTTQRKSDGRTTKHCCYLGK--TNEANISKVGY 175 H RI G CT K R L T Q+ G C GK T+++N+ K Sbjct: 527 HQRIHTGEKPYICTECGKVFTHR-TNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQK 585 Query: 176 SHTDTRRYSCS 208 +HT + Y C+ Sbjct: 586 THTGEKPYKCN 596
>Z585A_PONPY (Q5RDX1) Zinc finger protein 585A| Length = 737 Score = 29.3 bits (64), Expect = 5.5 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +2 Query: 2 HGRITYG*HANRCTNQSKKVQGR*VQLVTTQRKSDGRTTKHCCYLGK--TNEANISKVGY 175 H RI G C++ K + QL QR G C GK T+ +N++K Sbjct: 648 HHRIHTGEKPYECSDCGKSFTKK-SQLQVHQRIHTGEKPYVCAECGKAFTDRSNLNKHQT 706 Query: 176 SHTDTRRYSC 205 +HT R Y C Sbjct: 707 THTGDRPYKC 716
>Z585B_PONPY (Q5RB30) Zinc finger protein 585B| Length = 769 Score = 28.5 bits (62), Expect = 9.4 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +2 Query: 2 HGRITYG*HANRCTNQSKKVQGR*VQLVTTQRKSDGRTTKHCCYLGK--TNEANISKVGY 175 H RI G C++ K + QL QR G C GK +N +N++K Sbjct: 680 HHRIHTGEKPYECSDCGKSFTKK-SQLQVHQRIHTGEKPYVCAECGKAFSNRSNLNKHQT 738 Query: 176 SHTDTRRYSC 205 +HT + Y C Sbjct: 739 THTGDKPYKC 748
>Z585B_HUMAN (Q52M93) Zinc finger protein 585B (zinc finger protein 41-like| protein) Length = 769 Score = 28.5 bits (62), Expect = 9.4 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +2 Query: 2 HGRITYG*HANRCTNQSKKVQGR*VQLVTTQRKSDGRTTKHCCYLGK--TNEANISKVGY 175 H RI G C++ K + QL QR G C GK +N +N++K Sbjct: 680 HHRIHTGEKPYECSDCGKSFTKK-SQLQVHQRIHTGEKPYVCAECGKAFSNRSNLNKHQT 738 Query: 176 SHTDTRRYSC 205 +HT + Y C Sbjct: 739 THTGDKPYKC 748
>PFA3_YARLI (Q6C4W5) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Protein fatty| acyltransferase 3) Length = 401 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 224 RWFFWGCRSIF*CLYDCILPWRCWLHLSSLGSSNAWWFC-HPISFELSLT 78 +W F G ++ + + ++ W CW+H AW C P FE T Sbjct: 12 KWCFIGAKAFLPLVVNFLIIWACWVH--------AWLVCWEPQLFESDTT 53
>ZN200_HUMAN (P98182) Zinc finger protein 200| Length = 394 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 80 LVTTQRKSDGRTTKHCCYLGKT--NEANISKVGYSHTDTRRYSCS 208 L++ QR G C + GK+ ++ N++K HT + YSCS Sbjct: 266 LISHQRTHTGEKPYDCNHCGKSFNHKTNLNKHERIHTGEKPYSCS 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,078,452 Number of Sequences: 219361 Number of extensions: 1306393 Number of successful extensions: 2725 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2721 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)