ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart33g05 |
|---|---|
| Clone Library Name | barley_pub |
>UXS1_XENTR (Q6DF08) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UXS-1) Length = 421 Score = 49.7 bits (117), Expect = 4e-06 Identities = 25/61 (40%), Positives = 35/61 (57%) Frame = -1 Query: 499 AENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRER 320 A +K+L+ ++ DDP++RKPDI KAK +L WEP V L +GL FR+ Sbjct: 336 ARLIKQLVGSGGEISFLSEAQDDPQRRKPDIRKAKLLLGWEPVVPLEEGLNKTIHYFRKE 395 Query: 319 L 317 L Sbjct: 396 L 396
>UXS1_RAT (Q5PQX0) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 49.3 bits (116), Expect = 6e-06 Identities = 25/61 (40%), Positives = 34/61 (55%) Frame = -1 Query: 499 AENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRER 320 A+ +K L+ + DDP++RKPDI KAK +L WEP V L +GL FR+ Sbjct: 335 AQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKE 394 Query: 319 L 317 L Sbjct: 395 L 395
>UXS1_PONPY (Q5R885) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 49.3 bits (116), Expect = 6e-06 Identities = 25/61 (40%), Positives = 34/61 (55%) Frame = -1 Query: 499 AENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRER 320 A+ +K L+ + DDP++RKPDI KAK +L WEP V L +GL FR+ Sbjct: 335 AQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKE 394 Query: 319 L 317 L Sbjct: 395 L 395
>UXS1_MOUSE (Q91XL3) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 49.3 bits (116), Expect = 6e-06 Identities = 25/61 (40%), Positives = 34/61 (55%) Frame = -1 Query: 499 AENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRER 320 A+ +K L+ + DDP++RKPDI KAK +L WEP V L +GL FR+ Sbjct: 335 AQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKE 394 Query: 319 L 317 L Sbjct: 395 L 395
>UXS1_HUMAN (Q8NBZ7) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 49.3 bits (116), Expect = 6e-06 Identities = 25/61 (40%), Positives = 34/61 (55%) Frame = -1 Query: 499 AENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRER 320 A+ +K L+ + DDP++RKPDI KAK +L WEP V L +GL FR+ Sbjct: 335 AQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKE 394 Query: 319 L 317 L Sbjct: 395 L 395
>UXS1_BRARE (Q6GMI9) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UXS-1) Length = 418 Score = 46.2 bits (108), Expect = 5e-05 Identities = 21/50 (42%), Positives = 30/50 (60%) Frame = -1 Query: 499 AENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGL 350 A+ +K L+ + DDP++R+PDI KAK +L WEP V L +GL Sbjct: 333 AQLIKSLVASRSHIQFLPEAQDDPQRRRPDIRKAKLLLGWEPVVPLEEGL 382
>FCL1_ORYSA (Q67WR2) Probable GDP-L-fucose synthase 1 (EC 1.1.1.271)| (GDP-4-keto-6-deoxy-D-mannose-3, 5-epimerase-4-reductase 1) Length = 328 Score = 36.2 bits (82), Expect = 0.051 Identities = 22/67 (32%), Positives = 37/67 (55%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRE 323 LAE VKE++ + + + PD ++ D +K +E + W+PKV L++GLV + E Sbjct: 263 LAELVKEVVGFQGKLVWDSSKPDGTPRKLMDSSKIQE-MGWKPKVPLKEGLVETYKWYVE 321 Query: 322 RLAVPKK 302 + KK Sbjct: 322 NVISAKK 328
>ARNA_SALTI (Q8Z540) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 35.8 bits (81), Expect = 0.066 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKA 299 D RKP I A+ LDWEP + +RD + D F + + ++A Sbjct: 615 DVAHRKPSIDNARRCLDWEPSIAMRDTVEETLDFFLRSVDIAERA 659
>ARNA_SALPA (Q5PNA6) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 35.8 bits (81), Expect = 0.066 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKA 299 D RKP I A+ LDWEP + +RD + D F + + ++A Sbjct: 615 DVAHRKPSIDNARRCLDWEPSIAMRDTVEETLDFFLRSVDIAERA 659
>ARNA_SALCH (P0C0R6) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 33.5 bits (75), Expect = 0.33 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKA 299 D RKP I A+ L WEP + +RD + D F + V ++A Sbjct: 615 DVAHRKPSIDNARRCLGWEPSIAMRDTVEETLDFFLRSVDVAERA 659
>ARNA_PSEAE (Q9HY63) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 662 Score = 33.5 bits (75), Expect = 0.33 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKAKA 293 D RKP I A+ +LDW+P + LR+ + D F ++A+A Sbjct: 616 DVAHRKPSIDNARRLLDWQPTIELRETIGKTLDFFLHEALREREAQA 662
>ARNA_SALTY (O52325) Bifunctional polymyxin resistance arnA protein (Polymyxin| resistance protein pmrI) [Includes: UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1 Length = 660 Score = 33.1 bits (74), Expect = 0.43 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKA 299 D RKP I A+ L WEP + +RD + D F + + ++A Sbjct: 615 DVAHRKPSIDNARRCLGWEPSIAMRDTVEETLDFFLRSVDIAERA 659
>FCL1_ARATH (O49213) GDP-L-fucose synthase 1 (EC 1.1.1.271)| (GDP-4-keto-6-deoxy-D-mannose-3, 5-epimerase-4-reductase 1) (AtGER1) (AtFX) Length = 312 Score = 32.7 bits (73), Expect = 0.56 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGL 350 LAE VKE++ E + PD ++ D +K L W PKV LRDGL Sbjct: 249 LAELVKEVVGFEGKLGWDCTKPDGTPRKLMDSSKLAS-LGWTPKVSLRDGL 298
>ARNA_ECOL6 (Q8FFM1) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 32.3 bits (72), Expect = 0.73 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRD 356 D RKP I A+ LDWEPK+ +++ Sbjct: 615 DVEHRKPSIRNARRCLDWEPKIDMQE 640
>GALE_LACHE (Q7WTB1) UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase)| (UDP-galactose 4-epimerase) Length = 330 Score = 32.3 bits (72), Expect = 0.73 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPK 371 + E+ K++ ++ TM DP D TKA+ VL W+PK Sbjct: 262 ILESAKKVTGIDIPYTMGPRRGGDPDSLVADSTKARTVLGWKPK 305
>FCL2_ORYSA (Q67WR5) Putative GDP-L-fucose synthase 2 (EC 1.1.1.271)| (GDP-4-keto-6-deoxy-D-mannose-3, 5-epimerase-4-reductase 2) Length = 347 Score = 32.3 bits (72), Expect = 0.73 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGL 350 LAE V+ ++ E V P+ +R D + ++ L WEP+V LRDG+ Sbjct: 279 LAEAVRGVVGYEGVVAWDAARPEGVARRVVDSGRMRK-LGWEPRVALRDGI 328
>FCL2_ARATH (Q9LMU0) Putative GDP-L-fucose synthase 2 (EC 1.1.1.271)| (GDP-4-keto-6-deoxy-D-mannose-3, 5-epimerase-4-reductase 2) (AtGER2) Length = 328 Score = 32.0 bits (71), Expect = 0.95 Identities = 20/67 (29%), Positives = 33/67 (49%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRE 323 LAE VKE++ + + PD ++ D +K L W PK+ L+DGL + + E Sbjct: 263 LAELVKEVVGFKGKLVWDTTKPDGTPRKLMDSSKLAS-LGWTPKISLKDGLSQTYEWYLE 321 Query: 322 RLAVPKK 302 + K+ Sbjct: 322 NVVQKKQ 328
>ARNA_SHIFL (Q83QT8) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRD 356 D RKP I A LDWEPK+ +++ Sbjct: 615 DVEHRKPSIRNAHRCLDWEPKIDMQE 640
>ARNA_ECOLI (P77398) Bifunctional polymyxin resistance arnA protein (Polymyxin| resistance protein pmrI) [Includes: UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1 Length = 660 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRD 356 D RKP I A LDWEPK+ +++ Sbjct: 615 DVEHRKPSIRNAHRCLDWEPKIDMQE 640
>ARNA_ECO57 (Q8XDZ3) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRD 356 D RKP I A LDWEPK+ +++ Sbjct: 615 DVEHRKPSIRNAHHCLDWEPKIDMQE 640
>Y4NL_RHISN (P55584) Hypothetical 38.7 kDa protein y4nL| Length = 356 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -1 Query: 412 DITKAKEVLDWEPKVVLRDGL 350 DITKA++VL + PK+ LR+G+ Sbjct: 322 DITKARKVLGYAPKIALREGM 342
>EXOB_AZOBR (Q59083) UDP-glucose 4-epimerase (EC 5.1.3.2) (UDP-galactose| 4-epimerase) (Galactowaldenase) Length = 348 Score = 31.2 bits (69), Expect = 1.6 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLV 347 + ++E+ +V T + P DP Q + +E L W PK DG+V Sbjct: 270 VVRTLEEVSGEQVPATFADRRPGDPPQLVAGADRIREQLGWVPKHDRLDGIV 321
>RFBE_SALTI (P14169) CDP-paratose 2-epimerase (EC 5.1.3.10) (CDP-tyvelose| 2-epimerase) Length = 338 Score = 30.8 bits (68), Expect = 2.1 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = -1 Query: 490 VKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMED 335 +++ N ++ T D R DI K +DW PKV +DG+ M D Sbjct: 282 LEDYCNIDMRFTNLPVRESDQRVFVADIKKITNAIDWSPKVSAKDGVQKMYD 333
>GME2_ORYSA (Q2R1V8) GDP-mannose 3,5-epimerase 2 (EC 5.1.3.18) (GDP-Man| 3,5-epimerase 2) Length = 371 Score = 30.8 bits (68), Expect = 2.1 Identities = 20/51 (39%), Positives = 27/51 (52%) Frame = -1 Query: 439 PDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKAKA*G 287 P+ R R D T KE L W P + L+DGL + +E+L +K KA G Sbjct: 294 PEGVRGRNSDNTLIKEKLGWAPTMRLKDGLRITYFWIKEQL---EKEKAEG 341
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 30.8 bits (68), Expect = 2.1 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -2 Query: 384 TGSPRSSYVTAWCSWRTTSGSVWQCPRRPRPKATSLR-LAYITNLPEHTHSWVGSSIFV 211 T SP +S+ T CS T SG +WQC P P S++ A+I+ E + G +V Sbjct: 394 TYSPGTSFNTT-CSSCTCSGGLWQCQDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYV 451
>CINA_BACHK (Q6HF34) CinA-like protein| Length = 412 Score = 30.4 bits (67), Expect = 2.8 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENT-PDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFR 326 LAENVKEL+ ++ ++ T PD ++P + EP VV L R Sbjct: 335 LAENVKELLEADIGISFTGVAGPDASEHKEPGTVFVGLAIKDEPTVVFPLNLSGSRQQIR 394 Query: 325 ERLA 314 ER A Sbjct: 395 ERSA 398
>CINA_BACCZ (Q636P5) CinA-like protein| Length = 412 Score = 30.4 bits (67), Expect = 2.8 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENT-PDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFR 326 LAENVKEL+ ++ ++ T PD ++P + EP VV L R Sbjct: 335 LAENVKELLKADIGISFTGVAGPDASEHKEPGTVFVGLAIKDEPTVVFPLNLSGSRQQIR 394 Query: 325 ERLA 314 ER A Sbjct: 395 ERSA 398
>CINA_BACC1 (Q732U5) CinA-like protein| Length = 412 Score = 30.4 bits (67), Expect = 2.8 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENT-PDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFR 326 LAENVKEL+ ++ ++ T PD ++P + EP VV L R Sbjct: 335 LAENVKELLKADIGISFTGVAGPDASEHKEPGTVFVGLAIKDEPTVVFPLNLSGSRQQIR 394 Query: 325 ERLA 314 ER A Sbjct: 395 ERSA 398
>CINA_BACAN (Q81WQ3) CinA-like protein| Length = 412 Score = 30.4 bits (67), Expect = 2.8 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENT-PDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFR 326 LAENVKEL+ ++ ++ T PD ++P + EP VV L R Sbjct: 335 LAENVKELLEADIGISFTGVAGPDASEHKEPGTVFVGLAIKDEPTVVFPLNLSGSRQQIR 394 Query: 325 ERLA 314 ER A Sbjct: 395 ERSA 398
>GMD1_ARATH (Q9SNY3) GDP-mannose 4,6 dehydratase 1 (EC 4.2.1.47) (GDP-D-mannose| dehydratase 1) (GMD 1) Length = 361 Score = 30.4 bits (67), Expect = 2.8 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -1 Query: 439 PDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKAK 296 P + K D +KAKE+L W+PKV + +M D E L + K+ K Sbjct: 303 PTEVDNLKGDASKAKEMLGWKPKVGFEKLVKMMVD---EDLELAKREK 347
>ARNA_PSEF5 (Q4KC82) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 668 Score = 30.0 bits (66), Expect = 3.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLRD 356 D RKP I AK +L+WEP V + + Sbjct: 617 DVEHRKPSIDNAKRLLNWEPTVEMSE 642
>RECO_CHLMU (Q9PJS3) DNA repair protein recO (Recombination protein O)| Length = 234 Score = 30.0 bits (66), Expect = 3.6 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 10/77 (12%) Frame = -2 Query: 411 TSQRQRRFLTGSPRSSYVTAWCSWRTTSGS----------VWQCPRRPRPKATSLRLAYI 262 T + R+ L G ++ + T S+R + WQ +P P+ SL L ++ Sbjct: 62 TPPKMRKVLQGELKNPFTTIKNSYRLLQSTGKMIQAILKTQWQ--EKPSPQLFSLFLNFL 119 Query: 261 TNLPEHTHSWVGSSIFV 211 +PE H + SS+F+ Sbjct: 120 QRIPETPHPYFFSSMFL 136
>GME1_ORYSA (Q338B5) GDP-mannose 3,5-epimerase 1 (EC 5.1.3.18) (GDP-Man| 3,5-epimerase 1) (OsGME-1) Length = 378 Score = 30.0 bits (66), Expect = 3.6 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 439 PDDPRQRKPDITKAKEVLDWEPKVVLRDGL 350 P+ R R D T KE L W P + L+DGL Sbjct: 301 PEGVRGRNSDNTLIKEKLGWAPTMKLKDGL 330
>CINA_BACCR (Q81A15) CinA-like protein| Length = 412 Score = 29.6 bits (65), Expect = 4.7 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = -1 Query: 502 LAENVKELINPEVTVTMTENT-PDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFR 326 LAENVK+++ ++ ++ T PD Q++P + EP VV L R Sbjct: 335 LAENVKDVLKADIGISFTGVAGPDASEQKEPGTVFVGLSIKDEPTVVFPLNLSGSRQQIR 394 Query: 325 ERLA 314 ER A Sbjct: 395 ERTA 398
>TR2M_AGRTU (P0A3V3) Tryptophan 2-monooxygenase (EC 1.13.12.3)| Length = 755 Score = 29.6 bits (65), Expect = 4.7 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 12/61 (19%) Frame = -1 Query: 409 ITKAKEVLDWEPKVVLRDGLVLM----EDDFRERLAVPKKAK--------A*GHFPAFGV 266 I KA LD+EP+ GLVL+ EDD + LAVP K + FPAF Sbjct: 586 IAKAVYCLDYEPQDPNGKGLVLISYTWEDDSHKLLAVPDKKERLCLLRDAISRSFPAFAQ 645 Query: 265 H 263 H Sbjct: 646 H 646
>TR2M_AGRT4 (P0A3V2) Tryptophan 2-monooxygenase (EC 1.13.12.3)| Length = 755 Score = 29.6 bits (65), Expect = 4.7 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 12/61 (19%) Frame = -1 Query: 409 ITKAKEVLDWEPKVVLRDGLVLM----EDDFRERLAVPKKAK--------A*GHFPAFGV 266 I KA LD+EP+ GLVL+ EDD + LAVP K + FPAF Sbjct: 586 IAKAVYCLDYEPQDPNGKGLVLISYTWEDDSHKLLAVPDKKERLCLLRDAISRSFPAFAQ 645 Query: 265 H 263 H Sbjct: 646 H 646
>HSP82_ASHGO (Q8J2M3) Heat shock protein HSP82| Length = 704 Score = 29.3 bits (64), Expect = 6.2 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = -1 Query: 496 ENVKELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKVVLRDGLVLMEDDFRERL 317 ENVKEL T + P + Q + + DWE + ++ V + +FR L Sbjct: 257 ENVKELEELNKTKPLWTRNPSEVTQEEYNAFYKSISNDWEDPLAVKHFSVEGQLEFRAIL 316 Query: 316 AVPKKA 299 +PK+A Sbjct: 317 FIPKRA 322
>SECA1_MYCLE (P57996) Preprotein translocase secA 1 subunit| Length = 940 Score = 28.9 bits (63), Expect = 8.1 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -1 Query: 403 KAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKK 302 KAKE+ + + ++RDG VL+ D+F R+ + ++ Sbjct: 296 KAKELFNRDKDYIVRDGEVLIVDEFTGRVLIGRR 329
>ARNA_WIGBR (Q8D341) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 654 Score = 28.9 bits (63), Expect = 8.1 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 433 DPRQRKPDITKAKEVLDWEPKVVLR 359 D +RKP+I AK++L+W PK +R Sbjct: 614 DIDRRKPNIDIAKKLLNWTPKTKIR 638
>GMDS_HUMAN (O60547) GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose| dehydratase) (GMD) Length = 372 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 487 KELINPEVTVTMTENTPDDPRQRKPDITKAKEVLDWEPKV 368 KE VTV + P + + D TKAK+ L+W+P+V Sbjct: 310 KETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRV 349 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,862,622 Number of Sequences: 219361 Number of extensions: 1546511 Number of successful extensions: 3824 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 3726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3822 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
