| Clone Name | rbart33f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CWC2_CANGA (Q6FNR8) Pre-mRNA-splicing factor CWC2 | 29 | 2.9 | 2 | GSCR2_DROME (Q9W3C2) Hypothetical protein CG1785 | 29 | 3.8 |
|---|
>CWC2_CANGA (Q6FNR8) Pre-mRNA-splicing factor CWC2| Length = 306 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +1 Query: 40 LDCNWT*KFAEDRRNMRNVGSFQPDQSRALFIIN 141 LDC K AE+R +M VGSF Q+R L++ N Sbjct: 107 LDCFGREKHAENREDMAGVGSFN-QQNRTLYVGN 139
>GSCR2_DROME (Q9W3C2) Hypothetical protein CG1785| Length = 478 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 61 KFAEDRRNMRNVGSFQPDQSRALFIINSS 147 +F ED+R VG+F Q LF+++SS Sbjct: 31 QFLEDQRQEERVGTFADKQDEDLFVVDSS 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,774,558 Number of Sequences: 219361 Number of extensions: 425610 Number of successful extensions: 843 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)