Clone Name | rbart33e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YJIT_ECOLI (P39391) Hypothetical protein yjiT | 30 | 2.8 | 2 | CBP1_CAEEL (P34545) Protein cbp-1 | 30 | 2.8 | 3 | UT14C_HUMAN (Q5TAP6) U3 small nucleolar RNA-associated protein 1... | 29 | 6.2 |
---|
>YJIT_ECOLI (P39391) Hypothetical protein yjiT| Length = 521 Score = 30.4 bits (67), Expect = 2.8 Identities = 16/64 (25%), Positives = 31/64 (48%) Frame = -1 Query: 408 ASVCHRPDQACRVPLCSHFKAKAQTEKADKTWRLLVKKVTRAKVMSSLAERKVVPEVVAE 229 +++C+R AC V CS + + + TW + KK+ + + L +VP+ + + Sbjct: 74 SNICNRDFAACFVLFCSEWYRRDYERQCGWTWDPIYKKIGISFTATELG--TIVPKGMED 131 Query: 228 SWAR 217 W R Sbjct: 132 YWLR 135
>CBP1_CAEEL (P34545) Protein cbp-1| Length = 2056 Score = 30.4 bits (67), Expect = 2.8 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -1 Query: 441 CKRMLQLFRLHASVCHRPDQACRVPLCSHFKAKAQTEKADKTWR 310 CK+++ L HA C R AC VP C + + K +K + R Sbjct: 1604 CKQLIALCCYHAKHCTR--DACTVPFCMNIRQKLAEQKRSQQRR 1645
>UT14C_HUMAN (Q5TAP6) U3 small nucleolar RNA-associated protein 14 homolog C| Length = 766 Score = 29.3 bits (64), Expect = 6.2 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = -1 Query: 438 KRMLQLFRLHASVCHRPDQACRVPLCSHFKAKAQTEK--ADKTWRLLVKKVTRAKVMSSL 265 K LQ L + HR + L S+++AKA+ EK K + +VKK K + Sbjct: 208 KASLQAMSLEEAKMHRAELQRARALQSYYEAKARKEKKIKSKKYHKVVKKGKAKKALKEF 267 Query: 264 AE-RKVVPEVVAE 229 + +KV P V E Sbjct: 268 EQLQKVNPTVALE 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,445,209 Number of Sequences: 219361 Number of extensions: 827554 Number of successful extensions: 1948 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1948 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)