Clone Name | rbart33d09 |
---|---|
Clone Library Name | barley_pub |
>POT4_ARATH (Q9LD18) Potassium transporter 4 (AtPOT4) (AtKUP3) (AtKT4)| Length = 789 Score = 31.6 bits (70), Expect = 1.1 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -2 Query: 243 HGVRALHIIEFVGVNGGFGWIDVCFCQIT*NDLSTFLIDTGRFTGAPLFSYFSVQVGP 70 H V L+II+F V G GWI + ++ + G FT + F+V V P Sbjct: 252 HAVSPLYIIKFFRVTGQDGWISLGGVLLSVTGTEAMFANLGHFTSVSIRVAFAVVVYP 309
>FRIZ3_DROME (O77438) Protein frizzled-3 precursor (dFz3)| Length = 581 Score = 30.0 bits (66), Expect = 3.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 232 STPYYRVCRCEWWLRVD*CMFLSDHLK 152 +T Y +C WWL C +LS H K Sbjct: 323 TTSYLSLCAASWWLIFALCFYLSSHKK 349
>RAB6A_CAEEL (P34213) Ras-related protein Rab-6.1| Length = 205 Score = 29.6 bits (65), Expect = 4.2 Identities = 14/60 (23%), Positives = 25/60 (41%) Frame = +1 Query: 127 IYQKGGKVISSDLTKTYINPPEATIHTYKLDNMECSHSVTELAFDIRVVRPCNLFAAVVG 306 ++ G+ L +YI + Y + N H T+ D+R R C++ +VG Sbjct: 64 LWDTAGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVG 123
>KU86_HUMAN (P13010) ATP-dependent DNA helicase 2 subunit 2 (EC 3.6.1.-)| (ATP-dependent DNA helicase II 80 kDa subunit) (Lupus Ku autoantigen protein p86) (Ku86) (Ku80) (86 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding fac Length = 731 Score = 29.3 bits (64), Expect = 5.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 137 KVERSFQVI*QKHTSIHPKPPFTPTNSIIWSALTP 241 + +R FQ + H ++HP+ P P IW+ L P Sbjct: 485 RFQRLFQCL--LHRALHPREPLPPIQQHIWNMLNP 517
>TF7L1_MOUSE (Q9Z1J1) Transcription factor 7-like 1 (HMG box transcription| factor 3) (TCF-3) (mTCF-3) Length = 584 Score = 29.3 bits (64), Expect = 5.5 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = -1 Query: 364 PVIPPSDLHFSQARPPTRKAPLRRQTSYRDGPP*CQRLAPSRSESTPYY 218 P+I S+ HFS A PPT +P + + G P P SE +PYY Sbjct: 190 PLITYSNDHFSPASPPTHLSP---EIDPKTGIP----RPPHPSELSPYY 231
>PHR_NEUCR (P27526) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.3) (DNA| photolyase) (Photoreactivating enzyme) Length = 642 Score = 28.9 bits (63), Expect = 7.2 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = -1 Query: 361 VIPPSDLHF---SQARPPTRKAPLRRQTSYRDGPP*CQRLAPSRSESTP 224 V PP+ LHF + P RKA QTS+ +G P + + +++ P Sbjct: 14 VFPPTSLHFKLKTTMAPSKRKASAPPQTSHVNGNPSADKKRKTTTDAPP 62
>ADA2B_ELEMA (O19014) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) (Fragment) Length = 384 Score = 28.5 bits (62), Expect = 9.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 368 RSGDPAVRPPLLAGPAAYQKSPTTAAN 288 R G+P PL AGP+A SPT A++ Sbjct: 201 REGEPKQPHPLPAGPSALANSPTLASS 227 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,352,257 Number of Sequences: 219361 Number of extensions: 1401301 Number of successful extensions: 3620 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3619 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)