Clone Name | rbart33b07 |
---|---|
Clone Library Name | barley_pub |
>VIV1_MAIZE (P26307) Regulatory protein viviparous-1| Length = 691 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 105 GSMPPPSGETPPKNGGD 55 GS PP S E PP++GGD Sbjct: 6 GSSPPHSQENPPEHGGD 22
>M3K12_RAT (Q63796) Mitogen-activated protein kinase kinase kinase 12 (EC| 2.7.11.25) (Mixed lineage kinase) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK) (MAPK-upstream kinase) (MUK) Length = 888 Score = 28.5 bits (62), Expect = 5.3 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 105 GSMPPPSGETPPKNG 61 GS PPP G+TPP G Sbjct: 666 GSPPPPQGDTPPSEG 680
>M3K12_MOUSE (Q60700) Mitogen-activated protein kinase kinase kinase 12 (EC| 2.7.11.25) (Mixed lineage kinase) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK) (MAPK-upstream kinase) (MUK) Length = 888 Score = 28.5 bits (62), Expect = 5.3 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 105 GSMPPPSGETPPKNG 61 GS PPP G+TPP G Sbjct: 666 GSPPPPQGDTPPSEG 680
>NFYA6_ARATH (Q9LVJ7) Nuclear transcription factor Y subunit A-6 (AtNF-YA-6)| Length = 308 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 44 IKTVSPPFFGGVSPLGGGILPYKYINKENIQIPEI 148 I+ S P G V+P G L + Y ++ +Q P+I Sbjct: 119 IEAASWPLHGNVTPHFNGFLSFPYASQHTVQHPQI 153
>ALF_NEUCR (P53444) Fructose-bisphosphate aldolase (EC 4.1.2.13)| Length = 362 Score = 27.7 bits (60), Expect = 9.0 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 12 KPPSLWGIHDASKQYPPHFS--GGFPRWGGAYCPTN 113 +P +W I +A + P+FS GF G Y P N Sbjct: 201 QPEDIWQIEEAFRPISPYFSIAAGFGNVHGVYAPGN 236
>MOT3_MOUSE (O35308) Monocarboxylate transporter 3 (MCT 3) (Proton-coupled| monocarboxylate transporter 3) Length = 492 Score = 27.7 bits (60), Expect = 9.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 122 YLCICRAVCPPPAGKPPRK 66 + C C AV PP G PPR+ Sbjct: 186 HCCACGAVMRPPPGPPPRR 204
>POLS_EEVVM (P36331) Structural polyprotein (p130) [Contains: Capsid protein (EC| 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1254 Score = 27.7 bits (60), Expect = 9.0 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 9/44 (20%) Frame = +3 Query: 30 GIHDASKQYPPH-----FSGGFP-RWGGAYC---PTNT*IRRTY 134 G + S Y P FSG +P WGGAYC NT I + Y Sbjct: 876 GTQECSPTYRPDEQCKVFSGVYPFMWGGAYCFCDTENTQISKAY 919 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,353,211 Number of Sequences: 219361 Number of extensions: 669394 Number of successful extensions: 2150 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2126 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)