Clone Name | rbart33b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYV_PYRAE (Q8ZVG2) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 30 | 4.5 | 2 | SYIC_SCHPO (O13651) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6... | 30 | 4.5 | 3 | RPA1_RAT (O54889) DNA-directed RNA polymerase I largest subunit ... | 29 | 7.8 |
---|
>SYV_PYRAE (Q8ZVG2) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 799 Score = 30.0 bits (66), Expect = 4.5 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 453 WRLARFIAPRPRPTQTPRIGVLAPIDRSI 539 W ++RF+ P P Q P+ LAP+DR++ Sbjct: 588 WNISRFVLSFPEPQQKPQ---LAPVDRAL 613
>SYIC_SCHPO (O13651) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5)| (Isoleucine--tRNA ligase) (IleRS) Length = 1064 Score = 30.0 bits (66), Expect = 4.5 Identities = 17/55 (30%), Positives = 22/55 (40%) Frame = +1 Query: 223 DTHTHMLAHNRPPDDAMRRTL*SILAHVMSCW*EPGDPRYHRRHLPIFAVVVIKH 387 D H + H P + TL + + V CW E G Y RH P + KH Sbjct: 494 DIHRDSIDHITIPSKKGKGTLHRV-SEVFDCWFESGSMPYASRHYPFERIEEFKH 547
>RPA1_RAT (O54889) DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6)| (RNA polymerase I 194 kDa subunit) (RPA194) Length = 1716 Score = 29.3 bits (64), Expect = 7.8 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 291 ASKRSPHCIIGRAVVRK 241 A+KR PHC GR+VVRK Sbjct: 201 AAKRCPHCKTGRSVVRK 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,953,966 Number of Sequences: 219361 Number of extensions: 1613732 Number of successful extensions: 4442 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4429 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)