| Clone Name | rbart33a12 |
|---|---|
| Clone Library Name | barley_pub |
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 56.2 bits (134), Expect = 2e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 352 CTAIKADVLGIHINLPIHLSLILNFCGKGVPTGFMC 245 CTAIKA++LG ++NLPI LSL+LN CGK VP GF C Sbjct: 101 CTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFEC 136
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 54.3 bits (129), Expect = 7e-08 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 352 CTAIKADVLGIHINLPIHLSLILNFCGKGVPTGFMCP 242 CTAIKA+VLGIH+N+P+ L+ ILN CG+ P F CP Sbjct: 92 CTAIKANVLGIHLNVPLSLNFILNNCGRICPEDFTCP 128
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -3 Query: 352 CTAIKADVLGIHINLPIHLSLILNFCGKGVPTGFMCPT 239 CT I+ +L I+I LPI L ++++ CGK P F CP+ Sbjct: 308 CTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKCPS 345
>HPSE_SOYBN (P24337) Hydrophobic seed protein (HPS) (Allergen Gly m 1)| Length = 80 Score = 34.3 bits (77), Expect = 0.078 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -3 Query: 352 CTAIKADVLGIHINLPIHLSLILNFCGKGVPTGFMCP 242 C I+ LGI +NL +L LILN CG+ P+ CP Sbjct: 43 CLCIQLRALGI-LNLNRNLQLILNSCGRSYPSNATCP 78
>C1TC_RAT (P27653) C-1-tetrahydrofolate synthase, cytoplasmic (C1-THF| synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)] Length = 934 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Frame = -3 Query: 313 NLPI-----HLSLILNFCGKGVPTGFMCP 242 NLPI HLSL N KGVPTGF+ P Sbjct: 858 NLPICMAKTHLSLSHNPEQKGVPTGFVLP 886
>C1TC_MOUSE (Q922D8) C-1-tetrahydrofolate synthase, cytoplasmic (C1-THF| synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)] Length = 934 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Frame = -3 Query: 313 NLPI-----HLSLILNFCGKGVPTGFMCP 242 NLPI HLSL N KGVPTGF+ P Sbjct: 858 NLPICMAKTHLSLSHNPEQKGVPTGFVLP 886
>C1TC_HUMAN (P11586) C-1-tetrahydrofolate synthase, cytoplasmic (C1-THF| synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)] Length = 934 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Frame = -3 Query: 313 NLPI-----HLSLILNFCGKGVPTGFMCP 242 NLPI HLSL N KGVPTGF+ P Sbjct: 858 NLPICMAKTHLSLSHNPEQKGVPTGFILP 886
>L_VSVSJ (P03523) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2109 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 59 LAQATTQTFAKQYKTTKAKQIIERMHALRR 148 LAQ Q QYKT K++ ++E AL + Sbjct: 710 LAQGDNQVICTQYKTKKSRNVVELQGALNQ 739
>FCGR1_HUMAN (P12314) High affinity immunoglobulin gamma Fc receptor I precursor| (Fc-gamma RI) (FcRI) (IgG Fc receptor I) (CD64 antigen) Length = 374 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 26 HIPSQSKMQWPLAQATTQTFAKQYKTTKA 112 H+P S QW L TQT Y+ T A Sbjct: 47 HLPGSSSTQWFLNGTATQTSTPSYRITSA 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,149,347 Number of Sequences: 219361 Number of extensions: 731924 Number of successful extensions: 1917 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1913 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)