Clone Name | rbart33a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DCIP_ENTCL (P23234) Indole-3-pyruvate decarboxylase (EC 4.1.1.74... | 29 | 7.8 | 2 | SIRT1_HUMAN (Q96EB6) NAD-dependent deacetylase sirtuin-1 (EC 3.5... | 29 | 7.8 |
---|
>DCIP_ENTCL (P23234) Indole-3-pyruvate decarboxylase (EC 4.1.1.74)| (Indolepyruvate decarboxylase) Length = 552 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 153 LTVTPIISTLR--QHHFVFVLKSQFPSGDIILYTNSDVIHDCHRRQNDLCLW 4 LT+ + S LR QH + VL ++ YT IH +R ND+ LW Sbjct: 440 LTIQELGSMLRDKQHPIILVLNNEG-------YTVERAIHGAEQRYNDIALW 484
>SIRT1_HUMAN (Q96EB6) NAD-dependent deacetylase sirtuin-1 (EC 3.5.1.-) (hSIRT1)| (hSIR2) (SIR2-like protein 1) Length = 747 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = -3 Query: 403 TPSKRLKESSTPTRYGVWEREAGTPFFNSTPDCREDMNLHNSRGCLQNSPRVIEDS 236 TP ++SS+P R + + +D+++ S+GC++ P+ ++ S Sbjct: 530 TPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTS 585 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,086,627 Number of Sequences: 219361 Number of extensions: 1299008 Number of successful extensions: 3079 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3079 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)