Clone Name | rbart33a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CH60_PLAFG (P34940) Chaperonin CPN60, mitochondrial precursor | 29 | 5.4 | 2 | HCN2_RAT (Q9JKA9) Potassium/sodium hyperpolarization-activated c... | 29 | 7.1 | 3 | HCN2_MOUSE (O88703) Potassium/sodium hyperpolarization-activated... | 29 | 7.1 |
---|
>CH60_PLAFG (P34940) Chaperonin CPN60, mitochondrial precursor| Length = 700 Score = 29.3 bits (64), Expect = 5.4 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = -3 Query: 393 RLRMLFLYLGSMYLQAAYSVYEIRSSRNHQHLLV*S*IKY-TSPVMHRCKR--ILVETIA 223 R+ +LF+ + + L+ YS+ + RS N L + +KY S ++ R K + ++ Sbjct: 5 RIHILFVVIFLLCLRYGYSIKKKRSPNNKNRLFINKRLKYINSKIISRRKENYVKMKMTE 64 Query: 222 HSLKNKLAIFGQQ 184 + +K K I+G + Sbjct: 65 NKVKGKDIIYGNE 77
>HCN2_RAT (Q9JKA9) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 2 Length = 863 Score = 28.9 bits (63), Expect = 7.1 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +2 Query: 176 LFHC*PKMASLFFRECAIVSTKILL---HLCITGEVYLIQDHTSKCW 307 +FH +AS R C ++S +LL C+ V ++QD S CW Sbjct: 326 IFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCW 372
>HCN2_MOUSE (O88703) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 2 (Brain cyclic nucleotide gated channel 2) (BCNG-2) (Hyperpolarization-activated cation channel 1) (HAC-1) Length = 863 Score = 28.9 bits (63), Expect = 7.1 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +2 Query: 176 LFHC*PKMASLFFRECAIVSTKILL---HLCITGEVYLIQDHTSKCW 307 +FH +AS R C ++S +LL C+ V ++QD S CW Sbjct: 326 IFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCW 372 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,151,107 Number of Sequences: 219361 Number of extensions: 1225631 Number of successful extensions: 2349 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2349 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)