Clone Name | rbart33a06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TERT_OXYTR (O76332) Telomerase reverse transcriptase (EC 2.7.7.4... | 30 | 3.5 | 2 | HST4_YEAST (P53688) NAD-dependent deacetylase HST4 (EC 3.5.1.-) ... | 29 | 4.5 |
---|
>TERT_OXYTR (O76332) Telomerase reverse transcriptase (EC 2.7.7.49) (Telomerase| catalytic subunit) (Telomerase subunit P133) Length = 1132 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 11/49 (22%) Frame = -2 Query: 292 EQPAKIEYQSRYN-----------KQRFV*SSTVQYQTFGYLAVSNEFG 179 E+ AK+EY+ Y K+ + + + QTFGY V+NEFG Sbjct: 140 EKLAKLEYKLEYKNSYIDMISKVIKELLIENKLNKLQTFGYKLVNNEFG 188
>HST4_YEAST (P53688) NAD-dependent deacetylase HST4 (EC 3.5.1.-) (Homologous to| SIR2 protein 4) Length = 370 Score = 29.3 bits (64), Expect = 4.5 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 9/72 (12%) Frame = -3 Query: 408 VSLFASRAFCN*SSWKQILLPFSPVSNLLLLYAQS-DDAKNSLPRLNTN-------PGII 253 VSLF C + + ++L F+ LL LY Q+ D LP L+TN P + Sbjct: 151 VSLFRLSKNCQPTKFHEMLNEFARDGRLLRLYTQNIDGLDTQLPHLSTNVPLAKPIPSTV 210 Query: 252 N-RGSYNPAQCN 220 GS +CN Sbjct: 211 QLHGSIKHMECN 222 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,906,131 Number of Sequences: 219361 Number of extensions: 958693 Number of successful extensions: 1755 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1755 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)