Clone Name | rbart32g09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF3X_HUMAN (O75153) Putative eukaryotic translation initiation f... | 28 | 8.2 |
---|
>IF3X_HUMAN (O75153) Putative eukaryotic translation initiation factor 3| subunit (eIF-3) Length = 1309 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 119 QIHAQHARTQLVSIDPSVSWTMNDPPSLNFL 211 +IH +H R L S+DPS ++ D SL+FL Sbjct: 129 RIHVRHVRDLLKSLDPSDAFNGVDCNSLSFL 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,807,391 Number of Sequences: 219361 Number of extensions: 555015 Number of successful extensions: 1811 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1810 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)