| Clone Name | rbart32f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OCS1_MAIZE (P24068) Ocs element-binding factor 1 (OCSBF-1) | 103 | 2e-22 | 2 | K1199_MOUSE (Q8BI06) Protein KIAA1199 homolog precursor (Protein... | 29 | 7.3 |
|---|
>OCS1_MAIZE (P24068) Ocs element-binding factor 1 (OCSBF-1)| Length = 151 Score = 103 bits (257), Expect = 2e-22 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 478 RVDQENTVLRARAAELGDRLRSVNQVLRVVEEFSGVAMDIQEECPPDDPLLRPWQI 311 RV+QENTVLRARAAELGDRLRSVN+VLR+VEEFSGVAMDIQEE P DDPLLRPWQ+ Sbjct: 79 RVEQENTVLRARAAELGDRLRSVNEVLRLVEEFSGVAMDIQEEMPADDPLLRPWQL 134
>K1199_MOUSE (Q8BI06) Protein KIAA1199 homolog precursor (Protein 12H19.01.T7)| Length = 1361 Score = 28.9 bits (63), Expect = 7.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 394 VVEEFSGVAMDIQEECPPDDPLLRPW 317 ++ FSG + + ECP P L+PW Sbjct: 21 LLANFSGASSAVATECPDQSPELQPW 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,443,007 Number of Sequences: 219361 Number of extensions: 626564 Number of successful extensions: 1991 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1990 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)