Clone Name | rbart32f05 |
---|---|
Clone Library Name | barley_pub |
>PTPRK_HUMAN (Q15262) Receptor-type tyrosine-protein phosphatase kappa precursor| (EC 3.1.3.48) (Protein-tyrosine phosphatase kappa) (R-PTP-kappa) Length = 1439 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 116 STHTKIWEIGKNVNSLQTGQRKILHHRSYSASLHTSE 226 + H K+W +N + Q K ++HR ++AS E Sbjct: 223 AVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQE 259
>PTPRK_MOUSE (P35822) Receptor-type tyrosine-protein phosphatase kappa precursor| (EC 3.1.3.48) (Protein-tyrosine phosphatase kappa) (R-PTP-kappa) Length = 1457 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 116 STHTKIWEIGKNVNSLQTGQRKILHHRSYSASLHTSE 226 + H K+W +N + Q K ++HR ++AS E Sbjct: 222 AVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQE 258
>TAGG_BACSU (P42953) Teichoic acid translocation permease protein tagG| Length = 275 Score = 28.1 bits (61), Expect = 6.1 Identities = 20/70 (28%), Positives = 35/70 (50%) Frame = -2 Query: 221 MYASSLSKIYGEVSSVDQFVTSLRFYLFPRFWCVYSSCKMLGSLCGRIKP*YKTYPMWAT 42 ++ S++S + + + Q VT L F+L P FW V + LG + P K P++ Sbjct: 169 LFNSTISVLIRDYQFLLQAVTRLLFFLLPIFWDVNAK---LGQSHPELVPVLKLNPLF-- 223 Query: 41 YGCKGWNKSY 12 Y +G+ S+ Sbjct: 224 YIIEGFRNSF 233
>NOL6_MOUSE (Q8R5K4) Nucleolar protein 6 (Nucleolar RNA-associated protein)| (Nrap) Length = 1141 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 136 PDFGVCTPHVKCWAACVVALNPNIKLIR--CGQHTDVKDGINLI 11 PD+ TPH W VAL ++ L+ G +KDG+ L+ Sbjct: 283 PDYEPPTPHYNTWILQDVALETHMHLLASVLGSAQGLKDGVALL 326
>PRKDC_HUMAN (P78527) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) (DNPK1) (p460) Length = 4128 Score = 27.7 bits (60), Expect = 8.0 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -3 Query: 148 FTYFPDFGVCTPHVKCWAACVVALNPNIKLIRCGQHTDVKDGINLID 8 F++FP F C + C A +++L+P C GI L++ Sbjct: 2848 FSFFPPFVSCIQDISCQHAALLSLDPAAVSAGCLASLQQPVGIRLLE 2894
>MURC_PROMA (Q7VEJ1) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 472 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 94 ACVVALNPNIKLIRCGQHTDVKDGINL 14 +C +A NPN+ + C Q D+++ INL Sbjct: 418 SCTLANNPNLPIFTCKQLRDLENIINL 444 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,098,870 Number of Sequences: 219361 Number of extensions: 747379 Number of successful extensions: 1743 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1743 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)