Clone Name | rbart32d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RHM3_ARATH (Q9LH76) Probable rhamnose biosynthetic enzyme 3 (EC ... | 82 | 1e-15 | 2 | RHM1_ARATH (Q9SYM5) Probable rhamnose biosynthetic enzyme 1 (EC ... | 80 | 2e-15 | 3 | RHM2_ARATH (Q9LPG6) Probable rhamnose biosynthetic enzyme 2 (EC ... | 75 | 1e-13 | 4 | KPC1_CANAL (P43057) Protein kinase C-like 1 (EC 2.7.11.13) (PKC 1) | 29 | 6.3 | 5 | ATG2_YEAST (P53855) Autophagy-related protein 2 (Sporulation-spe... | 29 | 8.2 |
---|
>RHM3_ARATH (Q9LH76) Probable rhamnose biosynthetic enzyme 3 (EC 4.2.1.-) (EC| 1.1.1.-) Length = 664 Score = 81.6 bits (200), Expect = 1e-15 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -1 Query: 505 NFNLEEQAKVIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPNQKT 356 NFNLEEQAKVIVAPRSNNE+D KL EFPE+LSIK+SLIK VF+PN++T Sbjct: 615 NFNLEEQAKVIVAPRSNNEMDGAKLSKEFPEMLSIKDSLIKYVFEPNKRT 664
>RHM1_ARATH (Q9SYM5) Probable rhamnose biosynthetic enzyme 1 (EC 4.2.1.-) (EC| 1.1.1.-) Length = 669 Score = 80.5 bits (197), Expect = 2e-15 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = -1 Query: 505 NFNLEEQAKVIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPNQKT 356 NF LEEQAKVIVAPRSNNE+D KLK EFPELLSIKESLIK + PN+KT Sbjct: 620 NFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAYGPNKKT 669
>RHM2_ARATH (Q9LPG6) Probable rhamnose biosynthetic enzyme 2 (EC 4.2.1.-) (EC| 1.1.1.-) (RHAMNOSE BIOSYNTHESIS 2 protein) (NDP-rhamnose synthase) (MUCILAGE-MODIFIED4 protein) (UDP-L-rhamnose synthase MUM4) Length = 667 Score = 74.7 bits (182), Expect = 1e-13 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -1 Query: 505 NFNLEEQAKVIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPNQKT 356 NF +EEQAKVIVA RSNNE+D KL EFPE+LSIKESL+K VF+PN++T Sbjct: 618 NFTVEEQAKVIVAARSNNEMDGSKLSKEFPEMLSIKESLLKYVFEPNKRT 667
>KPC1_CANAL (P43057) Protein kinase C-like 1 (EC 2.7.11.13) (PKC 1)| Length = 1097 Score = 29.3 bits (64), Expect = 6.3 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 178 IPCHYQIITQN-TTWCCYCIL*IRWEMDRVRNKVLCCIVLSH 56 IP ++ IT + T WCC+C + W VR K C V+ H Sbjct: 479 IPHRFEPITNHGTKWCCHCGYILPWGKKNVR-KCTECGVMCH 519
>ATG2_YEAST (P53855) Autophagy-related protein 2 (Sporulation-specific protein| 72) Length = 1592 Score = 28.9 bits (63), Expect = 8.2 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = -2 Query: 375 SNQIRRHPRLDQMEQ----CAQSLMLMLLVRHTFTSLSGANPISMRSVLFRPGRVHALLL 208 SN+ P++ Q EQ C +SLM + + F LS N + M +++ VH L + Sbjct: 269 SNEDPSEPQVTQEEQENDKCKESLMEINNLNIAFKGLSSVNDLRMSNIVIDIQDVH-LAI 327 Query: 207 QEIVSYRKS 181 +IV + S Sbjct: 328 HKIVEIKNS 336 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,222,892 Number of Sequences: 219361 Number of extensions: 1617284 Number of successful extensions: 3276 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3276 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)