Clone Name | rbart32d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y441_MYCGE (P47679) Hypothetical protein MG441 | 30 | 1.4 | 2 | SEM4A_HUMAN (Q9H3S1) Semaphorin-4A precursor (Semaphorin B) (Sem... | 30 | 2.4 | 3 | SEM4A_MOUSE (Q62178) Semaphorin-4A precursor (Semaphorin B) (Sem... | 28 | 7.0 |
---|
>Y441_MYCGE (P47679) Hypothetical protein MG441| Length = 136 Score = 30.4 bits (67), Expect = 1.4 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = -2 Query: 144 VFAVLTLFLRFEQYVFFFFRNLGSRFDFFNHLIRANKNDISLYLII 7 VFA LFL + + FRN G RF F N SLYL++ Sbjct: 16 VFAFFVLFLFCLKIILVLFRNFGKRFKHFLF------NQTSLYLLV 55
>SEM4A_HUMAN (Q9H3S1) Semaphorin-4A precursor (Semaphorin B) (Sema B)| Length = 761 Score = 29.6 bits (65), Expect = 2.4 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = -2 Query: 108 QYVFFFFRNLGSRFDFFNHL-----IRANKNDI 25 Q V+FFF S FDFF L R KND+ Sbjct: 241 QVVYFFFEETASEFDFFERLHTSRVARVCKNDV 273
>SEM4A_MOUSE (Q62178) Semaphorin-4A precursor (Semaphorin B) (Sema B)| Length = 760 Score = 28.1 bits (61), Expect = 7.0 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = -2 Query: 108 QYVFFFFRNLGSRFDFFNHL-----IRANKNDI 25 Q V+FFF S FDFF L + KND+ Sbjct: 241 QVVYFFFEETASEFDFFEELYISRVAQVCKNDV 273 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,537,313 Number of Sequences: 219361 Number of extensions: 183496 Number of successful extensions: 330 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 330 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)