Clone Name | rbart32c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CBPY_YEAST (P00729) Carboxypeptidase Y precursor (EC 3.4.16.5) (... | 29 | 4.7 | 2 | Y1777_PYRFU (Q8U040) Putative HAD-hydrolase PF1777 (EC 3.-.-.-) | 29 | 6.2 | 3 | MIS_HUMAN (P03971) Muellerian-inhibiting factor precursor (MIS) ... | 28 | 8.1 | 4 | CBPY_CANAL (P30574) Carboxypeptidase Y precursor (EC 3.4.16.5) (... | 28 | 8.1 |
---|
>CBPY_YEAST (P00729) Carboxypeptidase Y precursor (EC 3.4.16.5)| (Carboxypeptidase YSCY) Length = 532 Score = 29.3 bits (64), Expect = 4.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 101 YTSQTIWHCAPATVY 145 Y SQ++W C PAT+Y Sbjct: 336 YDSQSVWSCVPATIY 350
>Y1777_PYRFU (Q8U040) Putative HAD-hydrolase PF1777 (EC 3.-.-.-)| Length = 240 Score = 28.9 bits (63), Expect = 6.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 404 RQIPGERATILRLRPTGYCPG 342 R++PG R T+LRL+ GY G Sbjct: 96 REVPGARKTLLRLKKEGYMTG 116
>MIS_HUMAN (P03971) Muellerian-inhibiting factor precursor (MIS)| (Anti-Muellerian hormone) (AMH) (Mullerian-inhibiting substance) Length = 560 Score = 28.5 bits (62), Expect = 8.1 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = -1 Query: 443 AVSVLPEG------PCEVRRQIPGERATILRLRPTGYCPGDQPLTGGPTSS 309 A++ P+G P + R + GE +L LRPT GD PTS+ Sbjct: 319 ALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDPAPLHDPTSA 369
>CBPY_CANAL (P30574) Carboxypeptidase Y precursor (EC 3.4.16.5)| (Carboxypeptidase YSCY) Length = 542 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +2 Query: 101 YTSQTIWHCAPATVYTHCSLQVQQQKDAPPPTVFRLQRSGRRSYCYCRL 247 Y S ++W C PAT+Y + QK R G S CY +L Sbjct: 348 YESGSVWSCVPATIYCNNGQMGPYQKTGRNVYDIRTMCEG-SSLCYSQL 395 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,659,527 Number of Sequences: 219361 Number of extensions: 1215673 Number of successful extensions: 2852 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2846 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)