Clone Name | rbart32b01 |
---|---|
Clone Library Name | barley_pub |
>ZO1_HUMAN (Q07157) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1748 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -2 Query: 205 HRPVSIEESTFERNERLVFGIPNPKTRRPCYCEL 104 H P ++EE T ERNE+ +P PK P Y ++ Sbjct: 362 HTPKTVEEVTVERNEKQTPSLPEPK---PVYAQV 392
>ZO1_MOUSE (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1745 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 205 HRPVSIEESTFERNERLVFGIPNPKTRRPCYCEL 104 H P ++EE T E+NE+ +P PK P Y ++ Sbjct: 362 HPPKAVEEVTVEKNEKQTPTLPEPK---PVYAQV 392
>GLI3_XENLA (Q91660) Zinc finger protein GLI3 (Neural-specific DNA-binding| protein xGLI3) (xGLI-3) Length = 1569 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -3 Query: 291 PAAWAPVAQDVDHH----HQEMSPFPVTHVAVTIDPSP 190 PA PV D HH H E +P P HV + SP Sbjct: 130 PAFHPPVPIDARHHEGRYHYEPTPIPPLHVPTALASSP 167
>COQ4_HUMAN (Q9Y3A0) Ubiquinone biosynthesis protein COQ4 homolog (Coenzyme Q| biosynthesis protein 4 homolog) Length = 265 Score = 27.3 bits (59), Expect = 9.8 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = -3 Query: 312 GVPGLRRPAAWAPVAQDVDHHHQEMSPFPVTHVAVTIDPSPLKKVLLRGMNA*FLAFPTR 133 G+PGL+RPAA P+ D P H + SPL+K LL +A + Sbjct: 14 GLPGLQRPAAEMPLRARSD----GAGPLYSHH----LPTSPLQKALLAAGSAAMALYNPY 65 Query: 132 KQDALATV 109 + D +A + Sbjct: 66 RHDMVAVL 73
>ATS19_HUMAN (Q8TE59) ADAMTS-19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 19) (ADAM-TS 19) (ADAM-TS19) Length = 1207 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 130 FSGWECQKLSVH-SSQKYFLQW 192 F W+CQ SV SS K+ LQW Sbjct: 692 FRDWQCQAYSVRTSSPKHILQW 713
>FEP1_SCHPO (Q10134) Iron-sensing transcription factor 1 (Transcription factor| gaf2) (Gaf-2) Length = 564 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -2 Query: 211 GYHRPVSIEESTFERNERLVF 149 G HRPV+++++ +R +RLVF Sbjct: 204 GVHRPVTMKKAIIKRRKRLVF 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,021,090 Number of Sequences: 219361 Number of extensions: 831172 Number of successful extensions: 1717 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1717 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)