Clone Name | rbart31g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PPBJ_RAT (P51740) Intestinal alkaline phosphatase 2 precursor (E... | 30 | 2.2 | 2 | GBX2_XENLA (Q91907) Homeobox protein GBX-2 (Gastrulation and bra... | 30 | 2.8 | 3 | SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Sh... | 28 | 8.2 |
---|
>PPBJ_RAT (P51740) Intestinal alkaline phosphatase 2 precursor (EC 3.1.3.1)| (IAP-II) Length = 551 Score = 30.4 bits (67), Expect = 2.2 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 7/55 (12%) Frame = +3 Query: 48 VFSSGTELESLH--KERNYFA*-----GTLRSYSSLQRAPPAVQHRPLIFQENAT 191 +F+ G + LH +E+NY A G L Y+ APPA ++RP +N+T Sbjct: 457 IFARGPQAHLLHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQNST 511
>GBX2_XENLA (Q91907) Homeobox protein GBX-2 (Gastrulation and brain-specific| homeobox protein 2) (XGBX-2) Length = 340 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -1 Query: 445 PPQRAPSPTLSKRSKCTSRSAAD*HHLHQFPSLP 344 PP P P+LS+ + ++ S+A HH H PSLP Sbjct: 56 PPPPPPPPSLSQATLQSTLSSA--HHHHPIPSLP 87
>SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Shank3)| (Proline-rich synapse associated protein 2) (ProSAP2) (SPANK-2) Length = 1815 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 451 PSPPQRAPSPTLSKRSK 401 P PP+RAPS TL+ RSK Sbjct: 752 PPPPKRAPSTTLTLRSK 768 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,851,598 Number of Sequences: 219361 Number of extensions: 1254463 Number of successful extensions: 2784 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2782 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)