Clone Name | rbart31g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NORR2_RALEU (Q9K4U8) Nitric oxide reductase transcription regula... | 30 | 1.9 | 2 | R13L1_ARATH (Q9LRR4) Putative disease resistance RPP13-like prot... | 30 | 3.2 | 3 | NORR1_RALEU (Q9K4V0) Nitric oxide reductase transcription regula... | 29 | 4.2 | 4 | YGEH_ECOLI (P76639) Hypothetical protein ygeH | 28 | 9.4 | 5 | YRM8_CAEEL (Q09417) Hypothetical WD-repeat protein R06F6.8 | 28 | 9.4 |
---|
>NORR2_RALEU (Q9K4U8) Nitric oxide reductase transcription regulator norR2| Length = 521 Score = 30.4 bits (67), Expect = 1.9 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = -1 Query: 307 LHPKILSIAGLRGIRCLH----APDCLQDL*PQMLGTKIPVKWVSGLSM 173 LHP++ +I RG+ C H PD L + +G +PV G S+ Sbjct: 71 LHPRLAAILARRGVTCFHHDSMLPDPYDGLIDEHVGEPLPVHDCMGTSL 119
>R13L1_ARATH (Q9LRR4) Putative disease resistance RPP13-like protein 1| Length = 1054 Score = 29.6 bits (65), Expect = 3.2 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -1 Query: 427 TYRNQSIALEKSPCQHMIPLYSPIQHWRLSQKPATMGCTSLHPKILSIAGLRG---IRCL 257 +YRN KS C ++ P+ H+ K CTSL+ LS LRG +R L Sbjct: 922 SYRNLQTLSIKSSCDTLVKF--PLNHFANLDKLEVDQCTSLYSLELSNEHLRGPNALRNL 979 Query: 256 HAPDC 242 DC Sbjct: 980 RINDC 984
>NORR1_RALEU (Q9K4V0) Nitric oxide reductase transcription regulator norR1| Length = 514 Score = 29.3 bits (64), Expect = 4.2 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Frame = -1 Query: 310 SLHPKILSIAGLRGIRCLH----APDCLQDL*PQMLGTKIPVKWVSGLSM 173 SLHP++ +I R + C H PD L + +G +PV G S+ Sbjct: 68 SLHPRLAAILARRDVTCFHHDSMLPDPYDGLIDEHVGEPLPVHDCMGTSL 117
>YGEH_ECOLI (P76639) Hypothetical protein ygeH| Length = 458 Score = 28.1 bits (61), Expect = 9.4 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -3 Query: 404 P*KISLPTYDPIVLANSTLEIVPEASDNGLYFFTS*DTEHC--WVTRNQMPSR 252 P SL T DP++L ++I+ +GLY + T C +++N SR Sbjct: 124 PFTTSLNTLDPLILNQELVQIISNKKIDGLYTYPMAATNFCNDHISQNSFLSR 176
>YRM8_CAEEL (Q09417) Hypothetical WD-repeat protein R06F6.8| Length = 1470 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 330 QRQWAVLLYILRY*ALLGYEESDAF--TPPTACKTCSHR 220 +++W + ++R+ +G E+ DAF TPP + KT R Sbjct: 951 EKKWTIAKEMVRFARSIGSEDIDAFFRTPPPSAKTSLSR 989 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,269,029 Number of Sequences: 219361 Number of extensions: 1311168 Number of successful extensions: 2866 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2866 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)