Clone Name | rbart31f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | QOR_YEAST (P38230) Probable quinone oxidoreductase (EC 1.6.5.5) ... | 31 | 1.6 | 2 | SERC_RALSO (Q8Y0Z0) Phosphoserine aminotransferase (EC 2.6.1.52)... | 31 | 1.6 | 3 | BUB1_HUMAN (O43683) Mitotic checkpoint serine/threonine-protein ... | 30 | 3.6 | 4 | RL17_XANCP (Q9Z3E6) 50S ribosomal protein L17 | 29 | 6.2 |
---|
>QOR_YEAST (P38230) Probable quinone oxidoreductase (EC 1.6.5.5)| (NADPH:quinone reductase) Length = 334 Score = 30.8 bits (68), Expect = 1.6 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -3 Query: 443 NELLSWLSKGLITVKISHTYRLTEAHLAFADLRDRKAVGKVMI 315 +E ++ + +KI TY L + A AD+ RK VGK+++ Sbjct: 288 DEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVL 330
>SERC_RALSO (Q8Y0Z0) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT)| Length = 378 Score = 30.8 bits (68), Expect = 1.6 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = -3 Query: 440 ELLSWLSKGLITVKISHTYRLTEAHL--AFADLRDRKAV 330 E+LSW G+ +++SH R E+ + AFADLR+ AV Sbjct: 36 EMLSWQGSGMSVMEMSHRGREFESIMAQAFADLRELLAV 74
>BUB1_HUMAN (O43683) Mitotic checkpoint serine/threonine-protein kinase BUB1 (EC| 2.7.11.1) (hBUB1) (BUB1A) Length = 1085 Score = 29.6 bits (65), Expect = 3.6 Identities = 17/58 (29%), Positives = 22/58 (37%) Frame = +1 Query: 4 YGTRADYRALQSFCSPRGLFSHPPVSSLW*PGILIQQSNGFQHITYTNPDCNIYEELD 177 +GT + C P GLF P +W N F H+ PDC+ LD Sbjct: 1000 FGTYMKVKNEGGECKPEGLFRRLPHLDMW---------NEFFHVMLNIPDCHHLPSLD 1048
>RL17_XANCP (Q9Z3E6) 50S ribosomal protein L17| Length = 127 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -3 Query: 365 LAFADLRDRKAVGKVMIVMG 306 LAFA LRD++AVGK+ + +G Sbjct: 65 LAFARLRDKEAVGKLFVELG 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,492,741 Number of Sequences: 219361 Number of extensions: 1188689 Number of successful extensions: 2825 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2825 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)